Lineage for d3ccvd1 (3ccv D:10-174)

  1. Root: SCOPe 2.08
  2. 3042554Class i: Low resolution protein structures [58117] (25 folds)
  3. 3042555Fold i.1: Ribosome and ribosomal fragments [58118] (1 superfamily)
  4. 3042556Superfamily i.1.1: Ribosome and ribosomal fragments [58119] (3 families) (S)
  5. 3043573Family i.1.1.2: Large subunit [58124] (3 proteins)
  6. 3043708Protein Prokaryotic (50S subunit) [58125] (3 species)
  7. 3043855Species Haloarcula marismortui [TaxId:2238] [58126] (20 PDB entries)
  8. 3044013Domain d3ccvd1: 3ccv D:10-174 [156456]
    Other proteins in same PDB: d3ccv21, d3ccvb1, d3ccvf1, d3ccvh1, d3ccvi1, d3ccvp1, d3ccvr1, d3ccvs1, d3ccvy1, d3ccvz1
    automatically matched to d1w2bd_
    complexed with cd, cl, k, mg, na, sr; mutant

Details for d3ccvd1

PDB Entry: 3ccv (more details), 2.9 Å

PDB Description: structure of anisomycin resistant 50s ribosomal subunit: 23s rrna mutation g2616a
PDB Compounds: (D:) 50S ribosomal protein L5P

SCOPe Domain Sequences for d3ccvd1:

Sequence, based on SEQRES records: (download)

>d3ccvd1 i.1.1.2 (D:10-174) Prokaryotic (50S subunit) {Haloarcula marismortui [TaxId: 2238]}
fhemrepriekvvvhmgighggrdlanaedilgeitgqmpvrtkakrtvgefdiregdpi
gakvtlrdemaeeflqtalplaelatsqfddtgnfsfgveehtefpsqeydpsigiygld
vtvnlvrpgyrvakrdkasrsiptkhrlnpadavafiestydvev

Sequence, based on observed residues (ATOM records): (download)

>d3ccvd1 i.1.1.2 (D:10-174) Prokaryotic (50S subunit) {Haloarcula marismortui [TaxId: 2238]}
fhemrepriekvvvhmgighanaedilgeitgqmpvrtkakrtvgefdiregdpigakvt
lrdemaeeflqtalplaelatsqfddtgnfsfgldvtvnlvrpgyrvakrdkasrsiptk
hrlnpadavafiestydvev

SCOPe Domain Coordinates for d3ccvd1:

Click to download the PDB-style file with coordinates for d3ccvd1.
(The format of our PDB-style files is described here.)

Timeline for d3ccvd1: