| Class i: Low resolution protein structures [58117] (25 folds) |
| Fold i.1: Ribosome and ribosomal fragments [58118] (1 superfamily) |
Superfamily i.1.1: Ribosome and ribosomal fragments [58119] (3 families) ![]() |
| Family i.1.1.2: Large subunit [58124] (3 proteins) |
| Protein Prokaryotic (50S subunit) [58125] (3 species) |
| Species Haloarcula marismortui [TaxId:2238] [58126] (20 PDB entries) |
| Domain d3ccv11: 3ccv 1:1-56 [156452] Other proteins in same PDB: d3ccv21, d3ccvb1, d3ccvf1, d3ccvh1, d3ccvi1, d3ccvp1, d3ccvr1, d3ccvs1, d3ccvy1, d3ccvz1 automatically matched to d1w2bz_ complexed with cd, cl, k, mg, na, sr; mutant |
PDB Entry: 3ccv (more details), 2.9 Å
SCOPe Domain Sequences for d3ccv11:
Sequence; same for both SEQRES and ATOM records: (download)
>d3ccv11 i.1.1.2 (1:1-56) Prokaryotic (50S subunit) {Haloarcula marismortui [TaxId: 2238]}
tgagtpsqgkknttthtkcrrcgeksyhtkkkvcsscgfgksakrrdyewqskage
Timeline for d3ccv11: