| Class a: All alpha proteins [46456] (290 folds) |
| Fold a.94: Ribosomal protein L19 (L19e) [48139] (1 superfamily) multihelical; consists of two different 3-helical domains connected by a long, partly helical linker |
Superfamily a.94.1: Ribosomal protein L19 (L19e) [48140] (1 family) ![]() automatically mapped to Pfam PF01280 |
| Family a.94.1.1: Ribosomal protein L19 (L19e) [48141] (1 protein) |
| Protein Ribosomal protein L19 (L19e) [48142] (1 species) |
| Species Haloarcula marismortui [TaxId:2238] [48143] (58 PDB entries) Uniprot P14119 |
| Domain d3ccvp1: 3ccv P:1-143 [156465] Other proteins in same PDB: d3ccv11, d3ccv21, d3ccv31, d3ccvb1, d3ccvd1, d3ccvf1, d3ccvh1, d3ccvi1, d3ccvj1, d3ccvk1, d3ccvl1, d3ccvn1, d3ccvo1, d3ccvq1, d3ccvr1, d3ccvs1, d3ccvt1, d3ccvu1, d3ccvv1, d3ccvw1, d3ccvx1, d3ccvy1, d3ccvz1 automatically matched to d1s72p_ complexed with cd, cl, k, mg, na, sr; mutant |
PDB Entry: 3ccv (more details), 2.9 Å
SCOPe Domain Sequences for d3ccvp1:
Sequence; same for both SEQRES and ATOM records: (download)
>d3ccvp1 a.94.1.1 (P:1-143) Ribosomal protein L19 (L19e) {Haloarcula marismortui [TaxId: 2238]}
tdlsaqkrlaadvldvgknrvwfnperqgdiadaitredvrelvdegaiqakdkkgnsrg
rarerqkkrayghqkgagsrkgkagarqnskedwesriraqrtklrelrdegtlsssqyr
dlydkagggefdsvadleryida
Timeline for d3ccvp1: