Lineage for d3ccvp1 (3ccv P:1-143)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2720880Fold a.94: Ribosomal protein L19 (L19e) [48139] (1 superfamily)
    multihelical; consists of two different 3-helical domains connected by a long, partly helical linker
  4. 2720881Superfamily a.94.1: Ribosomal protein L19 (L19e) [48140] (1 family) (S)
    automatically mapped to Pfam PF01280
  5. 2720882Family a.94.1.1: Ribosomal protein L19 (L19e) [48141] (1 protein)
  6. 2720883Protein Ribosomal protein L19 (L19e) [48142] (1 species)
  7. 2720884Species Haloarcula marismortui [TaxId:2238] [48143] (58 PDB entries)
    Uniprot P14119
  8. 2720928Domain d3ccvp1: 3ccv P:1-143 [156465]
    Other proteins in same PDB: d3ccv11, d3ccv21, d3ccv31, d3ccvb1, d3ccvd1, d3ccvf1, d3ccvh1, d3ccvi1, d3ccvj1, d3ccvk1, d3ccvl1, d3ccvn1, d3ccvo1, d3ccvq1, d3ccvr1, d3ccvs1, d3ccvt1, d3ccvu1, d3ccvv1, d3ccvw1, d3ccvx1, d3ccvy1, d3ccvz1
    automatically matched to d1s72p_
    complexed with cd, cl, k, mg, na, sr; mutant

Details for d3ccvp1

PDB Entry: 3ccv (more details), 2.9 Å

PDB Description: structure of anisomycin resistant 50s ribosomal subunit: 23s rrna mutation g2616a
PDB Compounds: (P:) 50S ribosomal protein L19e

SCOPe Domain Sequences for d3ccvp1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3ccvp1 a.94.1.1 (P:1-143) Ribosomal protein L19 (L19e) {Haloarcula marismortui [TaxId: 2238]}
tdlsaqkrlaadvldvgknrvwfnperqgdiadaitredvrelvdegaiqakdkkgnsrg
rarerqkkrayghqkgagsrkgkagarqnskedwesriraqrtklrelrdegtlsssqyr
dlydkagggefdsvadleryida

SCOPe Domain Coordinates for d3ccvp1:

Click to download the PDB-style file with coordinates for d3ccvp1.
(The format of our PDB-style files is described here.)

Timeline for d3ccvp1: