SCOPe 2.08: Domain d3buwb1: 3buw B:178-263

Lineage for d3buwb1 (3buw B:178-263)

1. Root: SCOPe 2.08

2. Class a: All alpha proteins [46456] (290 folds)

3. Fold a.39: EF Hand-like [47472] (4 superfamilies)
   core: 4 helices; array of 2 hairpins, opened

4. Superfamily a.39.1: EF-hand [47473] (12 families)
   Duplication: consists of two EF-hand units: each is made of two helices connected with calcium-binding loop

5. Family a.39.1.7: EF-hand modules in multidomain proteins [47547] (9 proteins)

6. Protein Cbl [47561] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [47562] (12 PDB entries)

8. Domain d3buwb1: 3buw B:178-263 [155641]
   Other proteins in same PDB: d3buwb2, d3buwb3, d3buwd2, d3buwd3
   automatically matched to d1b47a1

Details for d3buwb1

PDB Entry: 3buw, 1.45 Å

PDB Description: crystal structure of c-cbl-tkb domain complexed with its binding motif in syk

PDB Compounds: (B:) E3 ubiquitin-protein ligase CBL

SCOPe Domain Sequences for d3buwb1:

Sequence; same for both SEQRES and ATOM records:

>d3buwb1 a.39.1.7 (B:178-263) Cbl {Human (Homo sapiens) [TaxId: 9606]}
tfritkadaaefwrkafgektivpwksfrqalhevhpissgleamalkstidltcndyis
vfefdiftrlfqpwssllrnwnslav

Timeline for d3buwb1:

• d3buwb1 first appeared in SCOP 1.75
  
• d3buwb1 appears in SCOPe 2.07