Lineage for d3buwd3 (3buw D:264-351)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2965227Fold d.93: SH2-like [55549] (1 superfamily)
    3 layers: a/b/a; antiparallel beta-sheet of 5 strands is flanked by two helices
  4. 2965228Superfamily d.93.1: SH2 domain [55550] (2 families) (S)
  5. 2965229Family d.93.1.1: SH2 domain [55551] (35 proteins)
    Pfam PF00017
  6. 2965338Protein Cbl [55587] (1 species)
  7. 2965339Species Human (Homo sapiens) [TaxId:9606] [55588] (12 PDB entries)
  8. 2965343Domain d3buwd3: 3buw D:264-351 [155646]
    Other proteins in same PDB: d3buwb1, d3buwb2, d3buwd1, d3buwd2
    automatically matched to d1fbva3

Details for d3buwd3

PDB Entry: 3buw (more details), 1.45 Å

PDB Description: crystal structure of c-cbl-tkb domain complexed with its binding motif in syk
PDB Compounds: (D:) E3 ubiquitin-protein ligase CBL

SCOPe Domain Sequences for d3buwd3:

Sequence; same for both SEQRES and ATOM records: (download)

>d3buwd3 d.93.1.1 (D:264-351) Cbl {Human (Homo sapiens) [TaxId: 9606]}
thpgymafltydevkarlqkfihkpgsyifrlsctrlgqwaigyvtadgnilqtiphnkp
lfqalidgfregfylfpdgrnqnpdltg

SCOPe Domain Coordinates for d3buwd3:

Click to download the PDB-style file with coordinates for d3buwd3.
(The format of our PDB-style files is described here.)

Timeline for d3buwd3: