| Class a: All alpha proteins [46456] (290 folds) |
| Fold a.48: N-cbl like [47667] (5 superfamilies) 4 helices; bundle, left-handed twist; left-handed superhelix |
Superfamily a.48.1: N-terminal domain of cbl (N-cbl) [47668] (2 families) ![]() automatically mapped to Pfam PF02262 |
| Family a.48.1.1: N-terminal domain of cbl (N-cbl) [47669] (1 protein) |
| Protein N-terminal domain of cbl (N-cbl) [47670] (1 species) |
| Species Human (Homo sapiens) [TaxId:9606] [47671] (13 PDB entries) |
| Domain d3buwd2: 3buw D:48-177 [155645] Other proteins in same PDB: d3buwb1, d3buwb3, d3buwd1, d3buwd3 automatically matched to d1b47a2 |
PDB Entry: 3buw (more details), 1.45 Å
SCOPe Domain Sequences for d3buwd2:
Sequence; same for both SEQRES and ATOM records: (download)
>d3buwd2 a.48.1.1 (D:48-177) N-terminal domain of cbl (N-cbl) {Human (Homo sapiens) [TaxId: 9606]}
pgtvdkkmvekcwklmdkvvrlcqnpklalknsppyildllpdtyqhlrtilsryegkme
tlgeneyfrvfmenlmkktkqtislfkegkermyeensqprrnltklslifshmlaelkg
ifpsglfqgd
Timeline for d3buwd2: