SCOPe 2.01: Domain d3bt1u3: 3bt1 U:92-188

Lineage for d3bt1u3 (3bt1 U:92-188)

1. Root: SCOPe 2.01

2. Class g: Small proteins [56992] (90 folds)

3. Fold g.7: Snake toxin-like [57301] (1 superfamily)
   disulfide-rich fold: nearly all-beta

4. Superfamily g.7.1: Snake toxin-like [57302] (4 families)

5. Family g.7.1.3: Extracellular domain of cell surface receptors [57354] (7 proteins)

6. Protein Urokinase plasminogen activator surface receptor, UPAR [161130] (1 species)
   duplication; comprises three domains of this fold

7. Species Human (Homo sapiens) [TaxId:9606] [161131] (4 PDB entries)
   Uniprot Q03405 111-210! Uniprot Q03405 114-210! Uniprot Q03405 211-297! Uniprot Q03405 211-301! Uniprot Q03405 23-102! Uniprot Q03405 23-104

8. Domain d3bt1u3: 3bt1 U:92-188 [155539]
   Other proteins in same PDB: d3bt1a1, d3bt1a2, d3bt1b_
   automatically matched to 2FD6 U:92-188
   complexed with nag

Details for d3bt1u3

PDB Entry: 3bt1, 2.8 Å

PDB Description: structure of urokinase receptor, urokinase and vitronectin complex

PDB Compounds: (U:) Urokinase plasminogen activator surface receptor

SCOPe Domain Sequences for d3bt1u3:

Sequence; same for both SEQRES and ATOM records:

>d3bt1u3 g.7.1.3 (U:92-188) Urokinase plasminogen activator surface receptor, UPAR {Human (Homo sapiens) [TaxId: 9606]}
yleciscgssdmscergrhqslqcrspeeqcldvvthwiqegeegrpkddrhlrgcgylp
gcpgsngfhnndtfhflkccnttkcnegpilelenlp

Timeline for d3bt1u3:

• d3bt1u3 first appeared in SCOP 1.75
  
• d3bt1u3 appears in SCOPe 2.02
  
• d3bt1u3 appears in the current release, SCOPe 2.08