Lineage for d3bt1b_ (3bt1 B:)

  1. Root: SCOPe 2.01
  2. 1061255Class g: Small proteins [56992] (90 folds)
  3. 1067480Fold g.64: Somatomedin B domain [90187] (1 superfamily)
    disulfide-rich
  4. 1067481Superfamily g.64.1: Somatomedin B domain [90188] (1 family) (S)
  5. 1067482Family g.64.1.1: Somatomedin B domain [90189] (1 protein)
  6. 1067483Protein Vitronectin [90190] (1 species)
  7. 1067484Species Human (Homo sapiens) [TaxId:9606] [90191] (6 PDB entries)
    Uniprot P04004 20-70
  8. 1067487Domain d3bt1b_: 3bt1 B: [155536]
    Other proteins in same PDB: d3bt1a1, d3bt1a2, d3bt1u1, d3bt1u2, d3bt1u3
    automated match to d1s4ga_
    complexed with nag

Details for d3bt1b_

PDB Entry: 3bt1 (more details), 2.8 Å

PDB Description: structure of urokinase receptor, urokinase and vitronectin complex
PDB Compounds: (B:) Vitronectin

SCOPe Domain Sequences for d3bt1b_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3bt1b_ g.64.1.1 (B:) Vitronectin {Human (Homo sapiens) [TaxId: 9606]}
qesckgrctegfnvdkkcqcdelcsyyqscctdytaeckp

SCOPe Domain Coordinates for d3bt1b_:

Click to download the PDB-style file with coordinates for d3bt1b_.
(The format of our PDB-style files is described here.)

Timeline for d3bt1b_: