| Class g: Small proteins [56992] (90 folds) |
| Fold g.7: Snake toxin-like [57301] (1 superfamily) disulfide-rich fold: nearly all-beta |
Superfamily g.7.1: Snake toxin-like [57302] (4 families) ![]() |
| Family g.7.1.3: Extracellular domain of cell surface receptors [57354] (7 proteins) |
| Protein Urokinase plasminogen activator surface receptor, UPAR [161130] (1 species) duplication; comprises three domains of this fold |
| Species Human (Homo sapiens) [TaxId:9606] [161131] (4 PDB entries) Uniprot Q03405 111-210! Uniprot Q03405 114-210! Uniprot Q03405 211-297! Uniprot Q03405 211-301! Uniprot Q03405 23-102! Uniprot Q03405 23-104 |
| Domain d3bt1u2: 3bt1 U:189-275 [155538] Other proteins in same PDB: d3bt1a1, d3bt1a2, d3bt1b_ automatically matched to 2FD6 U:189-275 complexed with nag |
PDB Entry: 3bt1 (more details), 2.8 Å
SCOPe Domain Sequences for d3bt1u2:
Sequence; same for both SEQRES and ATOM records: (download)
>d3bt1u2 g.7.1.3 (U:189-275) Urokinase plasminogen activator surface receptor, UPAR {Human (Homo sapiens) [TaxId: 9606]}
qngrqcysckgnsthgcsseetflidcrgpmnqclvatgthepknqsymvrgcatasmcq
hahlgdafsmnhidvscctksgcnhpd
Timeline for d3bt1u2: