Class g: Small proteins [56992] (90 folds) |
Fold g.3: Knottins (small inhibitors, toxins, lectins) [57015] (19 superfamilies) disulfide-bound fold; contains beta-hairpin with two adjacent disulfides |
Superfamily g.3.11: EGF/Laminin [57196] (7 families) |
Family g.3.11.1: EGF-type module [57197] (23 proteins) |
Protein Plasminogen activator (urokinase-type) [57221] (1 species) |
Species Human (Homo sapiens) [TaxId:9606] [57222] (6 PDB entries) |
Domain d3bt1a1: 3bt1 A:8-49 [155534] Other proteins in same PDB: d3bt1a2, d3bt1b_, d3bt1u1, d3bt1u2, d3bt1u3 automatically matched to d1urka1 complexed with nag |
PDB Entry: 3bt1 (more details), 2.8 Å
SCOPe Domain Sequences for d3bt1a1:
Sequence; same for both SEQRES and ATOM records: (download)
>d3bt1a1 g.3.11.1 (A:8-49) Plasminogen activator (urokinase-type) {Human (Homo sapiens) [TaxId: 9606]} psncdclnggtcvsnkyfsnihwcncpkkfggqhceidkskt
Timeline for d3bt1a1:
View in 3D Domains from other chains: (mouse over for more information) d3bt1b_, d3bt1u1, d3bt1u2, d3bt1u3 |