SCOPe 2.08: Domain d3b2up1: 3b2u P:311-480

Lineage for d3b2up1 (3b2u P:311-480)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.10: Leucine-rich repeat, LRR (right-handed beta-alpha superhelix) [52046] (3 superfamilies)
   2 curved layers, a/b; parallel beta-sheet; order 1234...N; there are sequence similarities between different superfamilies

4. Superfamily c.10.2: L domain-like [52058] (9 families)
   less regular structure consisting of variable repeats

5. Family c.10.2.5: L domain [52071] (6 proteins)
   this is a repeat family; one repeat unit is 1n8z C:42-66 found in domain

6. Protein EGF receptor extracellular domain [82326] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [82327] (7 PDB entries)

8. Domain d3b2up1: 3b2u P:311-480 [154790]
   Other proteins in same PDB: d3b2ua2, d3b2ua3, d3b2ub2, d3b2ub3, d3b2uc1, d3b2uc2, d3b2uc3, d3b2ud1, d3b2ud2, d3b2ue2, d3b2ue3, d3b2uf1, d3b2uf2, d3b2uf3, d3b2ug1, d3b2ug2, d3b2uh1, d3b2uh2, d3b2uh3, d3b2ui2, d3b2ui3, d3b2uj1, d3b2uj2, d3b2uj3, d3b2uk1, d3b2uk2, d3b2ul1, d3b2ul2, d3b2um2, d3b2um3, d3b2un1, d3b2un2, d3b2un3, d3b2uo1, d3b2uo2, d3b2up2, d3b2up3, d3b2uq1, d3b2uq2, d3b2uq3, d3b2ur1, d3b2ur2, d3b2us2, d3b2us3, d3b2ut1, d3b2ut2, d3b2ut3, d3b2uu1, d3b2uu2, d3b2uv2, d3b2uv3, d3b2uw1, d3b2uw2, d3b2uw3, d3b2ux1, d3b2ux2
   automated match to d4krla1
   complexed with nag, so4

Details for d3b2up1

PDB Entry: 3b2u, 2.58 Å

PDB Description: crystal structure of isolated domain iii of the extracellular region of the epidermal growth factor receptor in complex with the fab fragment of imc-11f8

PDB Compounds: (P:) Epidermal growth factor receptor

SCOPe Domain Sequences for d3b2up1:

Sequence; same for both SEQRES and ATOM records:

>d3b2up1 c.10.2.5 (P:311-480) EGF receptor extracellular domain {Human (Homo sapiens) [TaxId: 9606]}
kvcngigigefkdslsinatnikhfknctsisgdlhilpvafrgdsfthtppldpqeldi
lktvkeitgflliqawpenrtdlhafenleiirgrtkqhgqfslavvslnitslglrslk
eisdgdviisgnknlcyantinwkklfgtsgqktkiisnrgensckatgq

Timeline for d3b2up1:

• d3b2up1 first appeared in SCOP 1.75
  
• d3b2up1 appears in SCOPe 2.07