SCOPe 2.08: Domain d3b2uo2: 3b2u O:108-213

Lineage for d3b2uo2 (3b2u O:108-213)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.0: automated matches [191470] (1 protein)
   not a true family

6. Protein automated matches [190740] (31 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [187920] (1793 PDB entries)

8. Domain d3b2uo2: 3b2u O:108-213 [199018]
   Other proteins in same PDB: d3b2ua1, d3b2ua2, d3b2ua3, d3b2ub1, d3b2ub2, d3b2ub3, d3b2uc1, d3b2uc2, d3b2uc3, d3b2ue1, d3b2ue2, d3b2ue3, d3b2uf1, d3b2uf2, d3b2uf3, d3b2uh1, d3b2uh2, d3b2uh3, d3b2ui1, d3b2ui2, d3b2ui3, d3b2uj1, d3b2uj2, d3b2uj3, d3b2um1, d3b2um2, d3b2um3, d3b2un1, d3b2un2, d3b2un3, d3b2up1, d3b2up2, d3b2up3, d3b2uq1, d3b2uq2, d3b2uq3, d3b2us1, d3b2us2, d3b2us3, d3b2ut1, d3b2ut2, d3b2ut3, d3b2uv1, d3b2uv2, d3b2uv3, d3b2uw1, d3b2uw2, d3b2uw3
   automated match to d1f3dj2
   complexed with nag, so4

Details for d3b2uo2

PDB Entry: 3b2u, 2.58 Å

PDB Description: crystal structure of isolated domain iii of the extracellular region of the epidermal growth factor receptor in complex with the fab fragment of imc-11f8

PDB Compounds: (O:) IMC-11F8 FAB Light chain

SCOPe Domain Sequences for d3b2uo2:

Sequence; same for both SEQRES and ATOM records:

>d3b2uo2 b.1.1.0 (O:108-213) automated matches {Human (Homo sapiens) [TaxId: 9606]}
rtvaapsvfifppsdeqlksgtasvvcllnnfypreakvqwkvdnalqsgnsqesvteqd
skdstyslsstltlskadyekhkvyacevthqglsspvtksfnrga

Timeline for d3b2uo2:

• d3b2uo2 first appeared in SCOPe 2.03
  
• d3b2uo2 appears in SCOPe 2.07