Lineage for d3b2uc1 (3b2u C:6-121)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2739517Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2739518Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2739519Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins)
  6. 2739730Protein Immunoglobulin heavy chain variable domain, VH [88543] (22 species)
    VH domains of human and mouse antibodies are clustered by the sequence similarity within the germline encoded segment and then by the size of the complementarity determining regions CDR1 and CDR2, so the clusters may correspond to putative germline families in the species genomes; VH domains with artificial or grafted exogenous CDRs are listed as engineered species
  7. 2739899Species Human (Homo sapiens), cluster 3 [TaxId:9606] [88547] (30 PDB entries)
    Uniprot Q6N089 20-243 # 95% sequence identity; natural chimera: antibody heavy chain (Fab HYB3)
  8. 2739922Domain d3b2uc1: 3b2u C:6-121 [154774]
    Other proteins in same PDB: d3b2ua1, d3b2ua2, d3b2ua3, d3b2ub1, d3b2ub2, d3b2ub3, d3b2uc2, d3b2uc3, d3b2ud1, d3b2ud2, d3b2ue1, d3b2ue2, d3b2ue3, d3b2uf2, d3b2uf3, d3b2ug1, d3b2ug2, d3b2uh2, d3b2uh3, d3b2ui1, d3b2ui2, d3b2ui3, d3b2uj2, d3b2uj3, d3b2uk1, d3b2uk2, d3b2ul1, d3b2ul2, d3b2um1, d3b2um2, d3b2um3, d3b2un2, d3b2un3, d3b2uo1, d3b2uo2, d3b2up1, d3b2up2, d3b2up3, d3b2uq2, d3b2uq3, d3b2ur1, d3b2ur2, d3b2us1, d3b2us2, d3b2us3, d3b2ut2, d3b2ut3, d3b2uu1, d3b2uu2, d3b2uv1, d3b2uv2, d3b2uv3, d3b2uw2, d3b2uw3, d3b2ux1, d3b2ux2
    automatically matched to d1deeb1
    complexed with nag, so4

Details for d3b2uc1

PDB Entry: 3b2u (more details), 2.58 Å

PDB Description: crystal structure of isolated domain iii of the extracellular region of the epidermal growth factor receptor in complex with the fab fragment of imc-11f8
PDB Compounds: (C:) IMC-11F8 FAB Heavy chain

SCOPe Domain Sequences for d3b2uc1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3b2uc1 b.1.1.1 (C:6-121) Immunoglobulin heavy chain variable domain, VH {Human (Homo sapiens), cluster 3 [TaxId: 9606]}
esgpglvkpsqtlsltctvsggsissgdyywswirqppgkglewigyiyysgstdynpsl
ksrvtmsvdtsknqfslkvnsvtaadtavyycarvsifgvgtfdywgqgtlvtvss

SCOPe Domain Coordinates for d3b2uc1:

Click to download the PDB-style file with coordinates for d3b2uc1.
(The format of our PDB-style files is described here.)

Timeline for d3b2uc1:

View in 3D
Domains from other chains:
(mouse over for more information)
d3b2ua1, d3b2ua2, d3b2ua3, d3b2ub1, d3b2ub2, d3b2ub3, d3b2ud1, d3b2ud2, d3b2ue1, d3b2ue2, d3b2ue3, d3b2uf1, d3b2uf2, d3b2uf3, d3b2ug1, d3b2ug2, d3b2uh1, d3b2uh2, d3b2uh3, d3b2ui1, d3b2ui2, d3b2ui3, d3b2uj1, d3b2uj2, d3b2uj3, d3b2uk1, d3b2uk2, d3b2ul1, d3b2ul2, d3b2um1, d3b2um2, d3b2um3, d3b2un1, d3b2un2, d3b2un3, d3b2uo1, d3b2uo2, d3b2up1, d3b2up2, d3b2up3, d3b2uq1, d3b2uq2, d3b2uq3, d3b2ur1, d3b2ur2, d3b2us1, d3b2us2, d3b2us3, d3b2ut1, d3b2ut2, d3b2ut3, d3b2uu1, d3b2uu2, d3b2uv1, d3b2uv2, d3b2uv3, d3b2uw1, d3b2uw2, d3b2uw3, d3b2ux1, d3b2ux2