SCOPe Funding Alert: SCOPe support from the NIH ended in April 2016. John-Marc Chandonia is the primary maintainer and has continued to develop SCOPe using vacation time. Three proposals to the NIH for continued funding have been unsuccessful. If our current NIH proposal is not funded, SCOPe will shut down permanently in Summer 2017 as Dr. Chandonia will need to seek a new position.

Lineage for d3b2ui1 (3b2u I:311-480)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2098542Fold c.10: Leucine-rich repeat, LRR (right-handed beta-alpha superhelix) [52046] (3 superfamilies)
    2 curved layers, a/b; parallel beta-sheet; order 1234...N; there are sequence similarities between different superfamilies
  4. 2098611Superfamily c.10.2: L domain-like [52058] (9 families) (S)
    less regular structure consisting of variable repeats
  5. 2098687Family c.10.2.5: L domain [52071] (6 protein domains)
  6. 2098688Protein EGF receptor extracellular domain [82326] (1 species)
  7. 2098689Species Human (Homo sapiens) [TaxId:9606] [82327] (7 PDB entries)
  8. 2098694Domain d3b2ui1: 3b2u I:311-480 [154782]
    Other proteins in same PDB: d3b2ua2, d3b2ua3, d3b2ub2, d3b2ub3, d3b2uc1, d3b2uc2, d3b2ud1, d3b2ud2, d3b2ue2, d3b2ue3, d3b2uf1, d3b2uf2, d3b2ug1, d3b2ug2, d3b2uh1, d3b2uh2, d3b2ui2, d3b2ui3, d3b2uj1, d3b2uj2, d3b2uk1, d3b2uk2, d3b2ul1, d3b2ul2, d3b2um2, d3b2um3, d3b2un1, d3b2un2, d3b2uo1, d3b2uo2, d3b2up2, d3b2up3, d3b2uq1, d3b2uq2, d3b2ur1, d3b2ur2, d3b2us2, d3b2us3, d3b2ut1, d3b2ut2, d3b2uu1, d3b2uu2, d3b2uv2, d3b2uv3, d3b2uw1, d3b2uw2, d3b2ux1, d3b2ux2
    automated match to d4krla1
    complexed with nag, so4

Details for d3b2ui1

PDB Entry: 3b2u (more details), 2.58 Å

PDB Description: Crystal structure of isolated domain III of the extracellular region of the epidermal growth factor receptor in complex with the Fab fragment of IMC-11F8
PDB Compounds: (I:) Epidermal growth factor receptor

SCOPe Domain Sequences for d3b2ui1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3b2ui1 c.10.2.5 (I:311-480) EGF receptor extracellular domain {Human (Homo sapiens) [TaxId: 9606]}
kvcngigigefkdslsinatnikhfknctsisgdlhilpvafrgdsfthtppldpqeldi
lktvkeitgflliqawpenrtdlhafenleiirgrtkqhgqfslavvslnitslglrslk
eisdgdviisgnknlcyantinwkklfgtsgqktkiisnrgensckatgq

SCOPe Domain Coordinates for d3b2ui1:

Click to download the PDB-style file with coordinates for d3b2ui1.
(The format of our PDB-style files is described here.)

Timeline for d3b2ui1:

View in 3D
Domains from other chains:
(mouse over for more information)
d3b2ua1, d3b2ua2, d3b2ua3, d3b2ub1, d3b2ub2, d3b2ub3, d3b2uc1, d3b2uc2, d3b2ud1, d3b2ud2, d3b2ue1, d3b2ue2, d3b2ue3, d3b2uf1, d3b2uf2, d3b2ug1, d3b2ug2, d3b2uh1, d3b2uh2, d3b2uj1, d3b2uj2, d3b2uk1, d3b2uk2, d3b2ul1, d3b2ul2, d3b2um1, d3b2um2, d3b2um3, d3b2un1, d3b2un2, d3b2uo1, d3b2uo2, d3b2up1, d3b2up2, d3b2up3, d3b2uq1, d3b2uq2, d3b2ur1, d3b2ur2, d3b2us1, d3b2us2, d3b2us3, d3b2ut1, d3b2ut2, d3b2uu1, d3b2uu2, d3b2uv1, d3b2uv2, d3b2uv3, d3b2uw1, d3b2uw2, d3b2ux1, d3b2ux2