SCOPe 2.08: Domain d3b2uh2: 3b2u H:122-221

Lineage for d3b2uh2 (3b2u H:122-221)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)

6. Protein Immunoglobulin heavy chain gamma constant domain 1, CH1-gamma [88574] (7 species)

7. Species Human (Homo sapiens) [TaxId:9606] [88575] (173 PDB entries)
   including humanized antibodies (chimeric proteins with human constant domains)
   Uniprot Q6N089 20-243 # 95% sequence identity; natural chimera: antibody heavy chain (Fab HYB3) ! SQ NA # humanized antibody ! Uniprot P01857 # IGHG1_HUMAN Ig gamma-1 chain C region ! SQ NA # engineered antibody

8. Domain d3b2uh2: 3b2u H:122-221 [154781]
   Other proteins in same PDB: d3b2ua1, d3b2ua2, d3b2ua3, d3b2ub1, d3b2ub2, d3b2ub3, d3b2uc1, d3b2uc3, d3b2ud1, d3b2ud2, d3b2ue1, d3b2ue2, d3b2ue3, d3b2uf1, d3b2uf3, d3b2ug1, d3b2ug2, d3b2uh1, d3b2uh3, d3b2ui1, d3b2ui2, d3b2ui3, d3b2uj1, d3b2uj3, d3b2uk1, d3b2uk2, d3b2ul1, d3b2ul2, d3b2um1, d3b2um2, d3b2um3, d3b2un1, d3b2un3, d3b2uo1, d3b2uo2, d3b2up1, d3b2up2, d3b2up3, d3b2uq1, d3b2uq3, d3b2ur1, d3b2ur2, d3b2us1, d3b2us2, d3b2us3, d3b2ut1, d3b2ut3, d3b2uu1, d3b2uu2, d3b2uv1, d3b2uv2, d3b2uv3, d3b2uw1, d3b2uw3, d3b2ux1, d3b2ux2
   automatically matched to d1ngzb2
   complexed with nag, so4

Details for d3b2uh2

PDB Entry: 3b2u, 2.58 Å

PDB Description: crystal structure of isolated domain iii of the extracellular region of the epidermal growth factor receptor in complex with the fab fragment of imc-11f8

PDB Compounds: (H:) IMC-11F8 FAB Heavy chain

SCOPe Domain Sequences for d3b2uh2:

Sequence, based on SEQRES records:

>d3b2uh2 b.1.1.2 (H:122-221) Immunoglobulin heavy chain gamma constant domain 1, CH1-gamma {Human (Homo sapiens) [TaxId: 9606]}
astkgpsvfplapsskstsggtaalgclvkdyfpepvtvswnsgaltsgvhtfpavlqss
glyslssvvtvpssslgtqtyicnvnhkpsntkvdkkvep

Sequence, based on observed residues (ATOM records):

>d3b2uh2 b.1.1.2 (H:122-221) Immunoglobulin heavy chain gamma constant domain 1, CH1-gamma {Human (Homo sapiens) [TaxId: 9606]}
astkgpsvfplapssgtaalgclvkdyfpepvtvswnsgaltsgvhtfpavlqssglysl
ssvvtvpssslgtqtyicnvnhkpsntkvdkkvep

Timeline for d3b2uh2:

• d3b2uh2 first appeared in SCOP 1.75
  
• d3b2uh2 appears in SCOPe 2.07