SCOP 1.75: Domain d3b2uh2: 3b2u H:122-221

Lineage for d3b2uh2 (3b2u H:122-221)

1. Root: SCOP 1.75

2. Class b: All beta proteins [48724] (174 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (28 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (4 families)

5. Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (23 proteins)

6. Protein Immunoglobulin heavy chain gamma constant domain 1, CH1-gamma [88574] (7 species)

7. Species Human (Homo sapiens) [TaxId:9606] [88575] (172 PDB entries)
   Uniprot Q6N089 20-243 # 95% sequence identity; natural chimera: antibody heavy chain (Fab HYB3)
   SQ NA # humanized antibody
   Uniprot P01857 # IGHG1_HUMAN Ig gamma-1 chain C region
   SQ NA # engineered antibody
   including humanized antibodies (chimeric proteins with human constant domains)
   Uniprot Q6N089 20-243 # 95% sequence identity; natural chimera: antibody heavy chain (Fab HYB3) ! SQ NA # humanized antibody ! Uniprot P01857 # IGHG1_HUMAN Ig gamma-1 chain C region ! SQ NA # engineered antibody

8. Domain d3b2uh2: 3b2u H:122-221 [154781]
   Other proteins in same PDB: d3b2ua1, d3b2ua2, d3b2ub1, d3b2ub2, d3b2uc1, d3b2ue1, d3b2ue2, d3b2uf1, d3b2uh1, d3b2ui1, d3b2ui2, d3b2uj1, d3b2um1, d3b2um2, d3b2un1, d3b2up1, d3b2up2, d3b2uq1, d3b2us1, d3b2us2, d3b2ut1, d3b2uv1, d3b2uv2, d3b2uw1
   automatically matched to d1ngzb2
   complexed with bma, man, nag, so4

Details for d3b2uh2

PDB Entry: 3b2u, 2.58 Å

PDB Description: crystal structure of isolated domain iii of the extracellular region of the epidermal growth factor receptor in complex with the fab fragment of imc-11f8

PDB Compounds: (H:) IMC-11F8 FAB Heavy chain

SCOP Domain Sequences for d3b2uh2:

Sequence, based on SEQRES records:

>d3b2uh2 b.1.1.2 (H:122-221) Immunoglobulin heavy chain gamma constant domain 1, CH1-gamma {Human (Homo sapiens) [TaxId: 9606]}
astkgpsvfplapsskstsggtaalgclvkdyfpepvtvswnsgaltsgvhtfpavlqss
glyslssvvtvpssslgtqtyicnvnhkpsntkvdkkvep

Sequence, based on observed residues (ATOM records):

>d3b2uh2 b.1.1.2 (H:122-221) Immunoglobulin heavy chain gamma constant domain 1, CH1-gamma {Human (Homo sapiens) [TaxId: 9606]}
astkgpsvfplapssgtaalgclvkdyfpepvtvswnsgaltsgvhtfpavlqssglysl
ssvvtvpssslgtqtyicnvnhkpsntkvdkkvep

Timeline for d3b2uh2:

• d3b2uh2 is new in SCOP 1.75
  
• d3b2uh2 appears in SCOPe 2.01
  
• d3b2uh2 appears in the current release, SCOPe 2.08