![]() | Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
![]() | Fold c.21: Ribosomal protein L13 [52160] (1 superfamily) 3 layers, a/b/a; core: parallel beta-sheet of 4 strands, order 3214 |
![]() | Superfamily c.21.1: Ribosomal protein L13 [52161] (1 family) ![]() |
![]() | Family c.21.1.1: Ribosomal protein L13 [52162] (1 protein) |
![]() | Protein Ribosomal protein L13 [52163] (5 species) synonym: 50S ribosomal protein L13p, HMAL13 |
![]() | Species Deinococcus radiodurans [TaxId:1299] [159475] (6 PDB entries) Uniprot Q9RXY1 30-171 |
![]() | Domain d2zjpg1: 2zjp G:30-171 [154499] Other proteins in same PDB: d2zjp11, d2zjp21, d2zjp31, d2zjp41, d2zjpa1, d2zjpa2, d2zjpb1, d2zjpc1, d2zjpd1, d2zjpe1, d2zjpe2, d2zjpf1, d2zjpf2, d2zjph1, d2zjpi1, d2zjpj1, d2zjpk1, d2zjpl1, d2zjpm1, d2zjpn1, d2zjpo1, d2zjpp1, d2zjpq1, d2zjpr1, d2zjps1, d2zjpt1, d2zjpu1, d2zjpv1, d2zjpw1, d2zjpy1 automatically matched to 2ZJR G:30-171 protein/RNA complex; complexed with mg, no1, zn |
PDB Entry: 2zjp (more details), 3.7 Å
SCOPe Domain Sequences for d2zjpg1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2zjpg1 c.21.1.1 (G:30-171) Ribosomal protein L13 {Deinococcus radiodurans [TaxId: 1299]} ktyipkndeqnwvvvdasgvplgrlatliasrirgkhrpdftpnmiqgdfvvvinaaqva ltgkklddkvytrytgyqgglktetarealskhperviehavfgmlpkgrqgramhtrlk vyagethphsaqkpqvlktqpl
Timeline for d2zjpg1:
![]() Domains from other chains: (mouse over for more information) d2zjp11, d2zjp21, d2zjp31, d2zjp41, d2zjpa1, d2zjpa2, d2zjpb1, d2zjpc1, d2zjpd1, d2zjpe1, d2zjpe2, d2zjpf1, d2zjpf2, d2zjph1, d2zjpi1, d2zjpj1, d2zjpk1, d2zjpl1, d2zjpm1, d2zjpn1, d2zjpo1, d2zjpp1, d2zjpq1, d2zjpr1, d2zjps1, d2zjpt1, d2zjpu1, d2zjpv1, d2zjpw1, d2zjpy1 |