Lineage for d2zjpi1 (2zjp I:4-144)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2852065Fold c.12: Ribosomal proteins L15p and L18e [52079] (1 superfamily)
    core: three turns of irregular (beta-beta-alpha)n superhelix
  4. 2852066Superfamily c.12.1: Ribosomal proteins L15p and L18e [52080] (1 family) (S)
  5. 2852067Family c.12.1.1: Ribosomal proteins L15p and L18e [52081] (2 proteins)
  6. 2852068Protein Ribosomal protein L15 (L15p) [52082] (4 species)
  7. 2852069Species Deinococcus radiodurans [TaxId:1299] [159455] (6 PDB entries)
    Uniprot Q9RSK9 4-144
  8. 2852073Domain d2zjpi1: 2zjp I:4-144 [154501]
    Other proteins in same PDB: d2zjp11, d2zjp21, d2zjp31, d2zjp41, d2zjpa1, d2zjpa2, d2zjpb1, d2zjpc1, d2zjpd1, d2zjpe1, d2zjpe2, d2zjpf1, d2zjpf2, d2zjpg1, d2zjph1, d2zjpj1, d2zjpk1, d2zjpl1, d2zjpm1, d2zjpn1, d2zjpo1, d2zjpp1, d2zjpq1, d2zjpr1, d2zjps1, d2zjpt1, d2zjpu1, d2zjpv1, d2zjpw1, d2zjpy1
    automatically matched to 2ZJR I:4-144
    protein/RNA complex; complexed with mg, no1, zn

Details for d2zjpi1

PDB Entry: 2zjp (more details), 3.7 Å

PDB Description: thiopeptide antibiotic nosiheptide bound to the large ribosomal subunit of deinococcus radiodurans
PDB Compounds: (I:) 50S ribosomal protein L15

SCOPe Domain Sequences for d2zjpi1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2zjpi1 c.12.1.1 (I:4-144) Ribosomal protein L15 (L15p) {Deinococcus radiodurans [TaxId: 1299]}
hdlkptpgsrkdrkrvgrgpggtdktagrghkgqksrsgagkgaffeggrsrliarlpkr
gfnnvgttyevvklsqlqdledttfdrdtleayrlvrrknrpvkllasgeisravtvhvd
aasaaaikaveaaggrvvlpe

SCOPe Domain Coordinates for d2zjpi1:

Click to download the PDB-style file with coordinates for d2zjpi1.
(The format of our PDB-style files is described here.)

Timeline for d2zjpi1: