Lineage for d2zjpf1 (2zjp F:72-144)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2691777Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies)
    core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down
  4. 2695423Superfamily a.4.7: Ribosomal protein L11, C-terminal domain [46906] (1 family) (S)
  5. 2695424Family a.4.7.1: Ribosomal protein L11, C-terminal domain [46907] (1 protein)
  6. 2695425Protein Ribosomal protein L11, C-terminal domain [46908] (6 species)
  7. 2695438Species Deinococcus radiodurans [TaxId:1299] [158348] (4 PDB entries)
    Uniprot Q9RSS7 72-144
  8. 2695440Domain d2zjpf1: 2zjp F:72-144 [154497]
    Other proteins in same PDB: d2zjp11, d2zjp21, d2zjp31, d2zjp41, d2zjpa1, d2zjpa2, d2zjpb1, d2zjpc1, d2zjpd1, d2zjpe1, d2zjpe2, d2zjpf2, d2zjpg1, d2zjph1, d2zjpi1, d2zjpj1, d2zjpk1, d2zjpl1, d2zjpm1, d2zjpn1, d2zjpo1, d2zjpp1, d2zjpq1, d2zjpr1, d2zjps1, d2zjpt1, d2zjpu1, d2zjpv1, d2zjpw1, d2zjpy1
    automatically matched to 2ZJQ F:72-144
    protein/RNA complex; complexed with mg, no1, zn

Details for d2zjpf1

PDB Entry: 2zjp (more details), 3.7 Å

PDB Description: thiopeptide antibiotic nosiheptide bound to the large ribosomal subunit of deinococcus radiodurans
PDB Compounds: (F:) 50S ribosomal protein L11

SCOPe Domain Sequences for d2zjpf1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2zjpf1 a.4.7.1 (F:72-144) Ribosomal protein L11, C-terminal domain {Deinococcus radiodurans [TaxId: 1299]}
ppmsylirkaagigkgsstpnkakvgklnwdqvleiaktkmpdlnagsveaaantvagta
rsmgvtveggpna

SCOPe Domain Coordinates for d2zjpf1:

Click to download the PDB-style file with coordinates for d2zjpf1.
(The format of our PDB-style files is described here.)

Timeline for d2zjpf1: