SCOPe Funding Alert: SCOPe support from the NIH ended in April 2016. John-Marc Chandonia is the primary maintainer and has continued to develop SCOPe using vacation time. Three proposals to the NIH for continued funding have been unsuccessful. If our current NIH proposal is not funded, SCOPe will shut down permanently in Summer 2017 as Dr. Chandonia will need to seek a new position.

Lineage for d2zjps1 (2zjp S:1-175)

  1. Root: SCOPe 2.06
  2. 2017114Class b: All beta proteins [48724] (177 folds)
  3. 2061452Fold b.53: Ribosomal protein L25-like [50714] (1 superfamily)
    barrel, closed; n=6, S=10; complex topology
  4. 2061453Superfamily b.53.1: Ribosomal protein L25-like [50715] (3 families) (S)
  5. 2061454Family b.53.1.1: Ribosomal protein L25-like [50716] (2 protein domains)
  6. 2061489Protein Ribosomal protein TL5 (general stress protein CTC) [63798] (2 species)
    contains additional all-beta (sub)domain in the C-terminal extension
  7. 2061490Species Deinococcus radiodurans [TaxId:1299] [159200] (6 PDB entries)
    Uniprot Q9RX88 1-175
  8. 2061495Domain d2zjps1: 2zjp S:1-175 [154511]
    Other proteins in same PDB: d2zjp11, d2zjp21, d2zjp31, d2zjp41, d2zjpa1, d2zjpa2, d2zjpb1, d2zjpc1, d2zjpd1, d2zjpe1, d2zjpe2, d2zjpf1, d2zjpf2, d2zjpg1, d2zjph1, d2zjpi1, d2zjpj1, d2zjpk1, d2zjpl1, d2zjpm1, d2zjpn1, d2zjpo1, d2zjpp1, d2zjpq1, d2zjpr1, d2zjpt1, d2zjpu1, d2zjpv1, d2zjpw1, d2zjpy1
    automatically matched to 2ZJR S:1-175
    protein/RNA complex; complexed with mg, no1, zn

Details for d2zjps1

PDB Entry: 2zjp (more details), 3.7 Å

PDB Description: Thiopeptide antibiotic Nosiheptide bound to the large ribosomal subunit of Deinococcus radiodurans
PDB Compounds: (S:) 50S ribosomal protein L25

SCOPe Domain Sequences for d2zjps1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2zjps1 b.53.1.1 (S:1-175) Ribosomal protein TL5 (general stress protein CTC) {Deinococcus radiodurans [TaxId: 1299]}
meltakprtpkqkldesmiaavaynkennvsfaldrkafdrafrqqsttglfditvegge
tfpalvkavqmdkrkrapihvdfymvtygepvevsvpvhttgrsqgevqgglvdivvhnl
qivapgprripqelvvdvtkmnigdhitagdiklpegctlaadpeltvvsvlppr

SCOPe Domain Coordinates for d2zjps1:

Click to download the PDB-style file with coordinates for d2zjps1.
(The format of our PDB-style files is described here.)

Timeline for d2zjps1: