Lineage for d2zjps1 (2zjp S:1-175)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2802937Fold b.53: Ribosomal protein L25-like [50714] (1 superfamily)
    barrel, closed; n=6, S=10; complex topology
  4. 2802938Superfamily b.53.1: Ribosomal protein L25-like [50715] (3 families) (S)
  5. 2802939Family b.53.1.1: Ribosomal protein L25-like [50716] (2 proteins)
  6. 2802974Protein Ribosomal protein TL5 (general stress protein CTC) [63798] (2 species)
    contains additional all-beta (sub)domain in the C-terminal extension
  7. 2802975Species Deinococcus radiodurans [TaxId:1299] [159200] (6 PDB entries)
    Uniprot Q9RX88 1-175
  8. 2802979Domain d2zjps1: 2zjp S:1-175 [154511]
    Other proteins in same PDB: d2zjp11, d2zjp21, d2zjp31, d2zjp41, d2zjpa1, d2zjpa2, d2zjpb1, d2zjpc1, d2zjpd1, d2zjpe1, d2zjpe2, d2zjpf1, d2zjpf2, d2zjpg1, d2zjph1, d2zjpi1, d2zjpj1, d2zjpk1, d2zjpl1, d2zjpm1, d2zjpn1, d2zjpo1, d2zjpp1, d2zjpq1, d2zjpr1, d2zjpt1, d2zjpu1, d2zjpv1, d2zjpw1, d2zjpy1
    automatically matched to 2ZJR S:1-175
    protein/RNA complex; complexed with mg, no1, zn
    has additional subdomain(s) that are not in the common domain

Details for d2zjps1

PDB Entry: 2zjp (more details), 3.7 Å

PDB Description: thiopeptide antibiotic nosiheptide bound to the large ribosomal subunit of deinococcus radiodurans
PDB Compounds: (S:) 50S ribosomal protein L25

SCOPe Domain Sequences for d2zjps1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2zjps1 b.53.1.1 (S:1-175) Ribosomal protein TL5 (general stress protein CTC) {Deinococcus radiodurans [TaxId: 1299]}
meltakprtpkqkldesmiaavaynkennvsfaldrkafdrafrqqsttglfditvegge
tfpalvkavqmdkrkrapihvdfymvtygepvevsvpvhttgrsqgevqgglvdivvhnl
qivapgprripqelvvdvtkmnigdhitagdiklpegctlaadpeltvvsvlppr

SCOPe Domain Coordinates for d2zjps1:

Click to download the PDB-style file with coordinates for d2zjps1.
(The format of our PDB-style files is described here.)

Timeline for d2zjps1: