Lineage for d2zjp31 (2zjp 3:2-64)

  1. Root: SCOPe 2.07
  2. 2494617Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2566587Fold d.301: L35p-like [143033] (1 superfamily)
    core: alpha-beta(3)-alpha; 2layers a/b
  4. 2566588Superfamily d.301.1: L35p-like [143034] (1 family) (S)
    automatically mapped to Pfam PF01632
  5. 2566589Family d.301.1.1: Ribosomal protein L35p [143035] (1 protein)
    Pfam PF01632
  6. 2566590Protein Ribosomal protein L35p [143036] (3 species)
  7. 2566591Species Deinococcus radiodurans [TaxId:1299] [160056] (6 PDB entries)
    Uniprot Q9RSW6 2-64
  8. 2566596Domain d2zjp31: 2zjp 3:2-64 [154488]
    Other proteins in same PDB: d2zjp11, d2zjp21, d2zjp41, d2zjpa1, d2zjpa2, d2zjpb1, d2zjpc1, d2zjpd1, d2zjpe1, d2zjpe2, d2zjpf1, d2zjpf2, d2zjpg1, d2zjph1, d2zjpi1, d2zjpj1, d2zjpk1, d2zjpl1, d2zjpm1, d2zjpn1, d2zjpo1, d2zjpp1, d2zjpq1, d2zjpr1, d2zjps1, d2zjpt1, d2zjpu1, d2zjpv1, d2zjpw1, d2zjpy1
    automatically matched to 2ZJR 3:2-64
    protein/RNA complex; complexed with mg, no1, zn

Details for d2zjp31

PDB Entry: 2zjp (more details), 3.7 Å

PDB Description: Thiopeptide antibiotic Nosiheptide bound to the large ribosomal subunit of Deinococcus radiodurans
PDB Compounds: (3:) 50S ribosomal protein L35

SCOPe Domain Sequences for d2zjp31:

Sequence; same for both SEQRES and ATOM records: (download)

>d2zjp31 d.301.1.1 (3:2-64) Ribosomal protein L35p {Deinococcus radiodurans [TaxId: 1299]}
pkmkthkmakrrikitgtgkvmafksgkrhqntgksgdeirgkgkgfvlakaewarmklm
lpr

SCOPe Domain Coordinates for d2zjp31:

Click to download the PDB-style file with coordinates for d2zjp31.
(The format of our PDB-style files is described here.)

Timeline for d2zjp31: