SCOPe 2.07: Domain d2zjpg1: 2zjp G:30-171

Lineage for d2zjpg1 (2zjp G:30-171)

1. Root: SCOPe 2.07

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.21: Ribosomal protein L13 [52160] (1 superfamily)
   3 layers, a/b/a; core: parallel beta-sheet of 4 strands, order 3214

4. Superfamily c.21.1: Ribosomal protein L13 [52161] (1 family)

5. Family c.21.1.1: Ribosomal protein L13 [52162] (1 protein)

6. Protein Ribosomal protein L13 [52163] (5 species)
   synonym: 50S ribosomal protein L13p, HMAL13

7. Species Deinococcus radiodurans [TaxId:1299] [159475] (6 PDB entries)
   Uniprot Q9RXY1 30-171

8. Domain d2zjpg1: 2zjp G:30-171 [154499]
   Other proteins in same PDB: d2zjp11, d2zjp21, d2zjp31, d2zjp41, d2zjpa1, d2zjpa2, d2zjpb1, d2zjpc1, d2zjpd1, d2zjpe1, d2zjpe2, d2zjpf1, d2zjpf2, d2zjph1, d2zjpi1, d2zjpj1, d2zjpk1, d2zjpl1, d2zjpm1, d2zjpn1, d2zjpo1, d2zjpp1, d2zjpq1, d2zjpr1, d2zjps1, d2zjpt1, d2zjpu1, d2zjpv1, d2zjpw1, d2zjpy1
   automatically matched to 2ZJR G:30-171
   protein/RNA complex; complexed with mg, no1, zn

Details for d2zjpg1

PDB Entry: 2zjp, 3.7 Å

PDB Description: thiopeptide antibiotic nosiheptide bound to the large ribosomal subunit of deinococcus radiodurans

PDB Compounds: (G:) 50S ribosomal protein L13

SCOPe Domain Sequences for d2zjpg1:

Sequence; same for both SEQRES and ATOM records:

>d2zjpg1 c.21.1.1 (G:30-171) Ribosomal protein L13 {Deinococcus radiodurans [TaxId: 1299]}
ktyipkndeqnwvvvdasgvplgrlatliasrirgkhrpdftpnmiqgdfvvvinaaqva
ltgkklddkvytrytgyqgglktetarealskhperviehavfgmlpkgrqgramhtrlk
vyagethphsaqkpqvlktqpl

Timeline for d2zjpg1:

• d2zjpg1 first appeared in SCOP 1.75
  
• d2zjpg1 appears in SCOPe 2.06
  
• d2zjpg1 appears in the current release, SCOPe 2.08