| Class a: All alpha proteins [46456] (290 folds) |
| Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies) core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down |
Superfamily a.4.5: 'Winged helix' DNA-binding domain [46785] (86 families) ![]() contains a small beta-sheet (wing) |
| Family a.4.5.10: Replication initiation protein [46816] (3 proteins) duplication: tandem repeat of two "winged helix" domains arranged with the pseudo twofold symmetry |
| Protein RepE54 [46817] (1 species) |
| Species Escherichia coli, mini-F plasmid [TaxId:562] [46818] (2 PDB entries) |
| Domain d2z9oa2: 2z9o A:144-251 [154261] automated match to d1repc2 protein/DNA complex |
PDB Entry: 2z9o (more details), 3.14 Å
SCOPe Domain Sequences for d2z9oa2:
Sequence; same for both SEQRES and ATOM records: (download)
>d2z9oa2 a.4.5.10 (A:144-251) RepE54 {Escherichia coli, mini-F plasmid [TaxId: 562]}
nrftqfrlsetkeitnpyamrlyeslcqyrkpdgsgivslkidwiieryqlpqsyqrmpd
frrrflqvcvneinsrtpmrlsyiekkkgrqtthivfsfrditsmttg
Timeline for d2z9oa2: