| Class a: All alpha proteins [46456] (290 folds) |
| Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies) core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down |
Superfamily a.4.5: 'Winged helix' DNA-binding domain [46785] (86 families) ![]() contains a small beta-sheet (wing) |
| Family a.4.5.10: Replication initiation protein [46816] (3 proteins) duplication: tandem repeat of two "winged helix" domains arranged with the pseudo twofold symmetry |
| Protein RepE54 [46817] (1 species) |
| Species Escherichia coli, mini-F plasmid [TaxId:562] [46818] (2 PDB entries) |
| Domain d2z9ob1: 2z9o B:20-143 [154262] automated match to d1repc1 protein/DNA complex |
PDB Entry: 2z9o (more details), 3.14 Å
SCOPe Domain Sequences for d2z9ob1:
Sequence, based on SEQRES records: (download)
>d2z9ob1 a.4.5.10 (B:20-143) RepE54 {Escherichia coli, mini-F plasmid [TaxId: 562]}
qsndlteaayslsrdqkrmlylfvdqirksdgtlqehdgiceihvakyaeifgltsaeas
kdirqalksfagkevvfyrpeedagdekgyesfpwfikrahspsrglysvhinpylipff
iglq
>d2z9ob1 a.4.5.10 (B:20-143) RepE54 {Escherichia coli, mini-F plasmid [TaxId: 562]}
qsndlteaayslsrdqkrmlylfvdqidgiceihvakyaeifgltsaeaskdirqalksf
agkevvfyrpeedagdekgyesfpwfikrahspsrglysvhinpylipffiglq
Timeline for d2z9ob1: