SCOP 1.75: Domain d2z9oa2: 2z9o A:144-246

Lineage for d2z9oa2 (2z9o A:144-246)

1. Root: SCOP 1.75

2. Class a: All alpha proteins [46456] (284 folds)

3. Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies)
   core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down

4. Superfamily a.4.5: "Winged helix" DNA-binding domain [46785] (84 families)
   contains a small beta-sheet (wing)

5. Family a.4.5.10: Replication initiation protein [46816] (3 proteins)
   duplication: tandem repeat of two "winged helix" domains arranged with the pseudo twofold symmetry

6. Protein RepE54 [46817] (1 species)

7. Species Escherichia coli, mini-F plasmid [TaxId:562] [46818] (2 PDB entries)

8. Domain d2z9oa2: 2z9o A:144-246 [154261]
   automatically matched to d1repc2

Details for d2z9oa2

PDB Entry: 2z9o, 3.14 Å

PDB Description: Crystal structure of the dimeric form of RepE in complex with the repE operator DNA

PDB Compounds: (A:) Replication initiation protein

SCOP Domain Sequences for d2z9oa2:

Sequence; same for both SEQRES and ATOM records:

>d2z9oa2 a.4.5.10 (A:144-246) RepE54 {Escherichia coli, mini-F plasmid [TaxId: 562]}
nrftqfrlsetkeitnpyamrlyeslcqyrkpdgsgivslkidwiieryqlpqsyqrmpd
frrrflqvcvneinsrtpmrlsyiekkkgrqtthivfsfrdit

Timeline for d2z9oa2:

• d2z9oa2 is new in SCOP 1.75
  
• d2z9oa2 appears in SCOPe 2.01
  
• d2z9oa2 appears in the current release, SCOPe 2.08