Lineage for d2z9oa1 (2z9o A:21-143)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2691777Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies)
    core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down
  4. 2692959Superfamily a.4.5: 'Winged helix' DNA-binding domain [46785] (86 families) (S)
    contains a small beta-sheet (wing)
  5. 2693223Family a.4.5.10: Replication initiation protein [46816] (3 proteins)
    duplication: tandem repeat of two "winged helix" domains arranged with the pseudo twofold symmetry
  6. 2693224Protein RepE54 [46817] (1 species)
  7. 2693225Species Escherichia coli, mini-F plasmid [TaxId:562] [46818] (2 PDB entries)
  8. 2693228Domain d2z9oa1: 2z9o A:21-143 [154260]
    automated match to d1repc1
    protein/DNA complex

Details for d2z9oa1

PDB Entry: 2z9o (more details), 3.14 Å

PDB Description: Crystal structure of the dimeric form of RepE in complex with the repE operator DNA
PDB Compounds: (A:) Replication initiation protein

SCOPe Domain Sequences for d2z9oa1:

Sequence, based on SEQRES records: (download)

>d2z9oa1 a.4.5.10 (A:21-143) RepE54 {Escherichia coli, mini-F plasmid [TaxId: 562]}
sndlteaayslsrdqkrmlylfvdqirksdgtlqehdgiceihvakyaeifgltsaeask
dirqalksfagkevvfyrpeedagdekgyesfpwfikrahspsrglysvhinpylipffi
glq

Sequence, based on observed residues (ATOM records): (download)

>d2z9oa1 a.4.5.10 (A:21-143) RepE54 {Escherichia coli, mini-F plasmid [TaxId: 562]}
sndlteaayslsrdqkrmlylfvdqirdgiceihvakyaeifgltsaeaskdirqalksf
agkevvfyrpeedagdekgyesfpwfikrahspsrglysvhinpylipffiglq

SCOPe Domain Coordinates for d2z9oa1:

Click to download the PDB-style file with coordinates for d2z9oa1.
(The format of our PDB-style files is described here.)

Timeline for d2z9oa1:

View in 3D
Domains from same chain:
(mouse over for more information)
d2z9oa2