![]() | Class b: All beta proteins [48724] (180 folds) |
![]() | Fold b.6: Cupredoxin-like [49502] (2 superfamilies) sandwich; 7 strands in 2 sheets, greek-key variations: some members have additional 1-2 strands |
![]() | Superfamily b.6.1: Cupredoxins [49503] (8 families) ![]() contains copper-binding site |
![]() | Family b.6.1.3: Multidomain cupredoxins [49550] (15 proteins) |
![]() | Protein Nitrite reductase, NIR, C-terminal domain [418911] (5 species) |
![]() | Species Alcaligenes xylosoxidans [TaxId:85698] [419329] (24 PDB entries) Uniprot O68601 |
![]() | Domain d2vm3a2: 2vm3 A:160-335 [153313] Other proteins in same PDB: d2vm3a1 automated match to d1haua2 complexed with cu, pg4, zn has additional insertions and/or extensions that are not grouped together |
PDB Entry: 2vm3 (more details), 1.8 Å
SCOPe Domain Sequences for d2vm3a2:
Sequence; same for both SEQRES and ATOM records: (download)
>d2vm3a2 b.6.1.3 (A:160-335) Nitrite reductase, NIR, C-terminal domain {Alcaligenes xylosoxidans [TaxId: 85698]} qgkplhydraytigefdlyipkgpdgkykdyatlaesygdtvqvmrtltpshivfngkvg altganaltakvgetvllihsqanrdtrphligghgdwvwetgkfanppqrdletwfirg gsagaalytfkqpgvyaylnhnlieafelgaaghikvegkwnddlmkqikapapip
Timeline for d2vm3a2: