SCOPe 2.08: Domain d2vm3a1: 2vm3 A:3-159

Lineage for d2vm3a1 (2vm3 A:3-159)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.6: Cupredoxin-like [49502] (2 superfamilies)
   sandwich; 7 strands in 2 sheets, greek-key
   variations: some members have additional 1-2 strands

4. Superfamily b.6.1: Cupredoxins [49503] (8 families)
   contains copper-binding site

5. Family b.6.1.3: Multidomain cupredoxins [49550] (15 proteins)

6. Protein Nitrite reductase, NIR, N-terminal domain [418910] (5 species)

7. Species Alcaligenes xylosoxidans [TaxId:85698] [419328] (24 PDB entries)
   Uniprot O68601

8. Domain d2vm3a1: 2vm3 A:3-159 [153312]
   Other proteins in same PDB: d2vm3a2
   automated match to d1haua1
   complexed with cu, pg4, zn

Details for d2vm3a1

PDB Entry: 2vm3, 1.8 Å

PDB Description: structure of alcaligenes xylosoxidans in space group r3 - 1 of 2

PDB Compounds: (A:) dissimilatory copper-containing nitrite reductase

SCOPe Domain Sequences for d2vm3a1:

Sequence; same for both SEQRES and ATOM records:

>d2vm3a1 b.6.1.3 (A:3-159) Nitrite reductase, NIR, N-terminal domain {Alcaligenes xylosoxidans [TaxId: 85698]}
adklphtkvtlvappqvhpheqatksgpkvveftmtieekkmviddkgttlqamtfngsm
pgptlvvhegdyvqltlvnpatnamphnvdfhgatgalggakltnvnpgeqatlrfkadr
sgtfvyhcapegmvpwhvvsgmsgtlmvlprdglkdp

Timeline for d2vm3a1:

• d2vm3a1 first appeared in SCOP 1.75
  
• d2vm3a1 appears in SCOPe 2.07