Lineage for d2vm3a2 (2vm3 A:160-335)

  1. Root: SCOP 1.75
  2. 781541Class b: All beta proteins [48724] (174 folds)
  3. 791145Fold b.6: Cupredoxin-like [49502] (2 superfamilies)
    sandwich; 7 strands in 2 sheets, greek-key
    variations: some members have additional 1-2 strands
  4. 791146Superfamily b.6.1: Cupredoxins [49503] (7 families) (S)
    contains copper-binding site
  5. 791546Family b.6.1.3: Multidomain cupredoxins [49550] (7 proteins)
  6. 791669Protein Nitrite reductase, NIR [49551] (5 species)
    consists of two domains of this fold
  7. 791890Species Alcaligenes xylosoxidans [TaxId:85698] [49554] (31 PDB entries)
    Uniprot O68601 25-360
    Uniprot O68601 26-359
    Uniprot O68601
    Uniprot O68601 25-360 ! Uniprot O68601 26-359 ! Uniprot O68601
  8. 791934Domain d2vm3a2: 2vm3 A:160-335 [153313]
    automatically matched to d1gs6x2
    complexed with cu, pg4, zn

Details for d2vm3a2

PDB Entry: 2vm3 (more details), 1.8 Å

PDB Description: structure of alcaligenes xylosoxidans in space group r3 - 1 of 2
PDB Compounds: (A:) dissimilatory copper-containing nitrite reductase

SCOP Domain Sequences for d2vm3a2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2vm3a2 b.6.1.3 (A:160-335) Nitrite reductase, NIR {Alcaligenes xylosoxidans [TaxId: 85698]}
qgkplhydraytigefdlyipkgpdgkykdyatlaesygdtvqvmrtltpshivfngkvg
altganaltakvgetvllihsqanrdtrphligghgdwvwetgkfanppqrdletwfirg
gsagaalytfkqpgvyaylnhnlieafelgaaghikvegkwnddlmkqikapapip

SCOP Domain Coordinates for d2vm3a2:

Click to download the PDB-style file with coordinates for d2vm3a2.
(The format of our PDB-style files is described here.)

Timeline for d2vm3a2:

View in 3D
Domains from same chain:
(mouse over for more information)
d2vm3a1