PDB entry 2vm3

View 2vm3 on RCSB PDB site
Description: structure of alcaligenes xylosoxidans in space group r3 - 1 of 2
Class: oxidoreductase
Keywords: denitrification, nitrite reductase, ordered mechanism, oxidoreductase
Deposited on 2008-01-22, released 2008-02-05
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-09-29, with a file datestamp of 2009-09-25.
Experiment type: XRAY
Resolution: 1.8 Å
R-factor: 0.186
AEROSPACI score: 0.52 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: dissimilatory copper-containing nitrite reductase
    Species: ACHROMOBACTER XYLOSOXIDANS [TaxId:85698]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2vm3a1, d2vm3a2
  • Heterogens: CU, ZN, PG4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2vm3A (A:)
    qdadklphtkvtlvappqvhpheqatksgpkvveftmtieekkmviddkgttlqamtfng
    smpgptlvvhegdyvqltlvnpatnamphnvdfhgatgalggakltnvnpgeqatlrfka
    drsgtfvyhcapegmvpwhvvsgmsgtlmvlprdglkdpqgkplhydraytigefdlyip
    kgpdgkykdyatlaesygdtvqvmrtltpshivfngkvgaltganaltakvgetvllihs
    qanrdtrphligghgdwvwetgkfanppqrdletwfirggsagaalytfkqpgvyaylnh
    nlieafelgaaghikvegkwnddlmkqikapapipr
    

    Sequence, based on observed residues (ATOM records): (download)
    >2vm3A (A:)
    adklphtkvtlvappqvhpheqatksgpkvveftmtieekkmviddkgttlqamtfngsm
    pgptlvvhegdyvqltlvnpatnamphnvdfhgatgalggakltnvnpgeqatlrfkadr
    sgtfvyhcapegmvpwhvvsgmsgtlmvlprdglkdpqgkplhydraytigefdlyipkg
    pdgkykdyatlaesygdtvqvmrtltpshivfngkvgaltganaltakvgetvllihsqa
    nrdtrphligghgdwvwetgkfanppqrdletwfirggsagaalytfkqpgvyaylnhnl
    ieafelgaaghikvegkwnddlmkqikapapip