Class a: All alpha proteins [46456] (290 folds) |
Fold a.156: S13-like H2TH domain [81297] (1 superfamily) core: 3-4 helices |
Superfamily a.156.1: S13-like H2TH domain [46946] (4 families) contains a helix-two turns-helix (H2TH) motif |
Family a.156.1.1: Ribosomal protein S13 [46947] (1 protein) contains 3 helices and a beta-hairpin in the core and a non-globular C-terminal extension automatically mapped to Pfam PF00416 |
Protein Ribosomal protein S13 [46948] (2 species) |
Species Escherichia coli [TaxId:562] [158360] (26 PDB entries) Uniprot P0A7S9 1-114 |
Domain d2vhom1: 2vho M:1-114 [153135] Other proteins in same PDB: d2vhob1, d2vhoc1, d2vhoc2, d2vhod1, d2vhoe1, d2vhoe2, d2vhof1, d2vhog1, d2vhoh1, d2vhoi1, d2vhoj1, d2vhok1, d2vhol1, d2vhon1, d2vhoo1, d2vhop1, d2vhoq1, d2vhor1, d2vhos1, d2vhot1, d2vhou1 protein/RNA complex; complexed with mg protein/RNA complex; complexed with mg |
PDB Entry: 2vho (more details), 3.74 Å
SCOPe Domain Sequences for d2vhom1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2vhom1 a.156.1.1 (M:1-114) Ribosomal protein S13 {Escherichia coli [TaxId: 562]} ariaginipdhkhavialtsiygvgktrskailaaagiaedvkiselsegqidtlrdeva kfvvegdlrreismsikrlmdlgcyrglrhrrglpvrgqrtktnartrkgprkp
Timeline for d2vhom1: