Lineage for d2vhot1 (2vho T:2-86)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2696503Fold a.7: Spectrin repeat-like [46965] (16 superfamilies)
    3 helices; bundle, closed, left-handed twist; up-and-down
  4. 2696688Superfamily a.7.6: Ribosomal protein S20 [46992] (1 family) (S)
    automatically mapped to Pfam PF01649
  5. 2696689Family a.7.6.1: Ribosomal protein S20 [46993] (1 protein)
    this is a repeat family; one repeat unit is 2gyb T:4-86 found in domain
  6. 2696690Protein Ribosomal protein S20 [46994] (2 species)
  7. 2696691Species Escherichia coli [TaxId:562] [158365] (26 PDB entries)
    Uniprot P0A7U7 2-86
  8. 2696708Domain d2vhot1: 2vho T:2-86 [153142]
    Other proteins in same PDB: d2vhob1, d2vhoc1, d2vhoc2, d2vhod1, d2vhoe1, d2vhoe2, d2vhof1, d2vhog1, d2vhoh1, d2vhoi1, d2vhoj1, d2vhok1, d2vhol1, d2vhom1, d2vhon1, d2vhoo1, d2vhop1, d2vhoq1, d2vhor1, d2vhos1, d2vhou1
    protein/RNA complex; complexed with mg
    protein/RNA complex; complexed with mg

Details for d2vhot1

PDB Entry: 2vho (more details), 3.74 Å

PDB Description: Structure of PDF binding helix in complex with the ribosome (part 3 of 4)
PDB Compounds: (T:) 30S ribosomal protein S20

SCOPe Domain Sequences for d2vhot1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2vhot1 a.7.6.1 (T:2-86) Ribosomal protein S20 {Escherichia coli [TaxId: 562]}
niksakkraiqsekarkhnasrrsmmrtfikkvyaaieagdkaaaqkafnemqpivdrqa
akglihknkaarhkanltaqinkla

SCOPe Domain Coordinates for d2vhot1:

Click to download the PDB-style file with coordinates for d2vhot1.
(The format of our PDB-style files is described here.)

Timeline for d2vhot1: