Lineage for d2vhon1 (2vho N:1-100)

  1. Root: SCOPe 2.08
  2. 3029608Class g: Small proteins [56992] (100 folds)
  3. 3035586Fold g.39: Glucocorticoid receptor-like (DNA-binding domain) [57715] (1 superfamily)
    alpha+beta metal(zinc)-bound fold
  4. 3035587Superfamily g.39.1: Glucocorticoid receptor-like (DNA-binding domain) [57716] (19 families) (S)
  5. 3035919Family g.39.1.7: Ribosomal protein S14 [57752] (1 protein)
  6. 3035920Protein Ribosomal protein S14 [57753] (2 species)
  7. 3035921Species Escherichia coli [TaxId:562] [161162] (24 PDB entries)
    Uniprot P02370 1-100
  8. 3035938Domain d2vhon1: 2vho N:1-100 [153136]
    Other proteins in same PDB: d2vhob1, d2vhoc1, d2vhoc2, d2vhod1, d2vhoe1, d2vhoe2, d2vhof1, d2vhog1, d2vhoh1, d2vhoi1, d2vhoj1, d2vhok1, d2vhol1, d2vhom1, d2vhoo1, d2vhop1, d2vhoq1, d2vhor1, d2vhos1, d2vhot1, d2vhou1
    protein/RNA complex; complexed with mg
    protein/RNA complex; complexed with mg
    has additional insertions and/or extensions that are not grouped together

Details for d2vhon1

PDB Entry: 2vho (more details), 3.74 Å

PDB Description: Structure of PDF binding helix in complex with the ribosome (part 3 of 4)
PDB Compounds: (N:) 30S ribosomal protein S14

SCOPe Domain Sequences for d2vhon1:

Sequence, based on SEQRES records: (download)

>d2vhon1 g.39.1.7 (N:1-100) Ribosomal protein S14 {Escherichia coli [TaxId: 562]}
akqsmkarevkrvaladkyfakraelkaiisdvnasdedrwnavlklqtlprdsspsrqr
nrcrqtgrphgflrkfglsrikvreaamrgeipglkkasw

Sequence, based on observed residues (ATOM records): (download)

>d2vhon1 g.39.1.7 (N:1-100) Ribosomal protein S14 {Escherichia coli [TaxId: 562]}
akqsmkarevkrvaladkyfakraelkaiisdvnarwnavlklqtlprdsspsrqrnrcr
qtgrphgflrkfglsrikvreaamrgeipglkkasw

SCOPe Domain Coordinates for d2vhon1:

Click to download the PDB-style file with coordinates for d2vhon1.
(The format of our PDB-style files is described here.)

Timeline for d2vhon1: