PDB entry 2vho

View 2vho on RCSB PDB site
Description: Structure of PDF binding helix in complex with the ribosome (part 3 of 4)
Class: ribosome
Keywords: translation, peptide deformylase, RNA-protein complex, ribosomal protein, ribonucleoprotein, 30s ribosomal subunit, antibiotic resistance, ribosome, nascent chain processing, RNA-binding, translation regulation, tRNA-binding, protein biosynthesis
Deposited on 2007-11-22, released 2008-02-26
The last revision prior to the SCOPe 2.07 freeze date was dated 2014-12-10, with a file datestamp of 2014-12-05.
Experiment type: XRAY
Resolution: 3.74 Å
R-factor: 0.259
AEROSPACI score: 0.02 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: 16S ribosomal RNA
    Species: Escherichia coli [TaxId:562]
  • Chain 'B':
    Compound: 30S ribosomal protein S2
    Species: Escherichia coli [TaxId:562]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2vhob1
  • Chain 'C':
    Compound: 30S ribosomal protein S3
    Species: Escherichia coli [TaxId:562]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2vhoc1, d2vhoc2
  • Chain 'D':
    Compound: 30S ribosomal protein S4
    Species: Escherichia coli [TaxId:562]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2vhod1
  • Chain 'E':
    Compound: 30S ribosomal protein S5
    Species: Escherichia coli [TaxId:562]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2vhoe1, d2vhoe2
  • Chain 'F':
    Compound: 30S ribosomal protein S6
    Species: Escherichia coli [TaxId:562]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P0A4D0 (0-End)
    • PDB 2VHO
    Domains in SCOPe 2.07: d2vhof1
  • Chain 'G':
    Compound: 30S ribosomal protein S7
    Species: Escherichia coli [TaxId:562]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2vhog1
  • Chain 'H':
    Compound: 30S ribosomal protein S8
    Species: Escherichia coli [TaxId:562]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2vhoh1
  • Chain 'I':
    Compound: 30S ribosomal protein S9
    Species: Escherichia coli [TaxId:562]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2vhoi1
  • Chain 'J':
    Compound: 30S ribosomal protein S10
    Species: Escherichia coli [TaxId:562]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2vhoj1
  • Chain 'K':
    Compound: 30S ribosomal protein S11
    Species: Escherichia coli [TaxId:562]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2vhok1
  • Chain 'L':
    Compound: 30S ribosomal protein S12
    Species: Escherichia coli [TaxId:562]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2vhol1
  • Chain 'M':
    Compound: 30S ribosomal protein S13
    Species: Escherichia coli [TaxId:562]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2vhom1
  • Chain 'N':
    Compound: 30S ribosomal protein S14
    Species: Escherichia coli [TaxId:562]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2vhon1
  • Chain 'O':
    Compound: 30S ribosomal protein S15
    Species: Escherichia coli [TaxId:562]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2vhoo1
  • Chain 'P':
    Compound: 30S ribosomal protein S16
    Species: Escherichia coli [TaxId:562]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2vhop1
  • Chain 'Q':
    Compound: 30S ribosomal protein S17
    Species: Escherichia coli [TaxId:562]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2vhoq1
  • Chain 'R':
    Compound: 30S ribosomal protein S18
    Species: Escherichia coli [TaxId:562]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2vhor1
  • Chain 'S':
    Compound: 30S ribosomal protein S19
    Species: Escherichia coli [TaxId:562]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2vhos1
  • Chain 'T':
    Compound: 30S ribosomal protein S20
    Species: Escherichia coli [TaxId:562]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2vhot1
  • Chain 'U':
    Compound: 30S ribosomal protein S21
    Species: Escherichia coli [TaxId:562]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2vhou1
  • Heterogens: MG, HOH

PDB Chain Sequences:

  • Chain 'A':
    No sequence available.

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2vhoB (B:)
    atvsmrdmlkagvhfghqtrywnpkmkpfifgarnkvhiinlektvpmfnealaelnkia
    srkgkilfvgtkraaseavkdaalscdqffvnhrwlggmltnwktvrqsikrlkdletqs
    qdgtfdkltkkealmrtreleklenslggikdmgglpdalfvidadhehiaikeannlgi
    pvfaivdtnsdpdgvdfvipgnddairavtlylgavaatvregrsqdlasqaeesfveae
    

    Sequence, based on observed residues (ATOM records): (download)
    >2vhoB (B:)
    mlkagvhfghqtrywnpkmkpfifgarnkvhiinlektvpmfnealaelnkiasrkgkil
    fvgtkraaseavkdaalscdqffvnhrwlggmltnwktvrqsikrlkdletqsqdgtfdk
    ltkkealmrtreleklenslggikdmgglpdalfvidadhehiaikeannlgipvfaivd
    tnsdpdgvdfvipgnddairavtlylgavaatvregrsq
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >2vhoC (C:)
    gqkvhpngirlgivkpwnstwfantkefadnldsdfkvrqyltkelakasvsrivierpa
    ksirvtihtarpgivigkkgedveklrkvvadiagvpaqiniaevrkpeldaklvadsit
    sqlerrvmfrramkravqnamrlgakgikvevsgrlggaeiartewyregrvplhtlrad
    idyntseahttygvigvkvwifkgeilggmaaveqpekpaaqpkkqqrkgrk
    

    Sequence, based on observed residues (ATOM records): (download)
    >2vhoC (C:)
    gqkvhpngirlgivkpwnstwfantkefadnldsdfkvrqyltkelakasvsrivierpa
    ksirvtihtarpgivigkkgedveklrkvvadiagvpaqiniaevrkpeldaklvadsit
    sqlerrvmfrramkravqnamrlgakgikvevsgrlggaeiartewyregrvplhtlrad
    idyntseahttygvigvkvwifkgeil
    

  • Chain 'D':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2vhoD (D:)
    arylgpklklsrregtdlflksgvraidtkckieqapgqhgarkprlsdygvqlrekqkv
    rriygvlerqfrnyykeaarlkgntgenllallegrldnvvyrmgfgatraearqlvshk
    aimvngrvvniasyqvspndvvsirekakkqsrvkaalelaeqrekptwlevdagkmegt
    fkrkpersdlsadinehlivelysk
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >2vhoE (E:)
    ahiekqagelqekliavnrvsktvkggrifsftaltvvgdgngrvgfgygkarevpaaiq
    kamekarrnminvalnngtlqhpvkgvhtgsrvfmqpasegtgiiaggamravlevagvh
    nvlakaygstnpinvvratidglenmnspemvaakrgksveeilgk
    

    Sequence, based on observed residues (ATOM records): (download)
    >2vhoE (E:)
    elqekliavnrvsktvkggrifsftaltvvgdgngrvgfgygkarevpaaiqkamekarr
    nminvalnngtlqhpvkgvhtgsrvfmqpasegtgiiaggamravlevagvhnvlakayg
    stnpinvvratidglenmnspemvaakrgks
    

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >2vhoF (F:)
    mrhyeivfmvhpdqseqvpgmierytaaitgaegkihrledwgrrqlaypinklhkahyv
    lmnveapqevidelettfrfndavirsmvmrtkhavteaspmvkakderrerrddfanet
    addaeagdseeeeee
    

    Sequence, based on observed residues (ATOM records): (download)
    >2vhoF (F:)
    mrhyeivfmvhpdqseqvpgmierytaaitgaegkihrledwgrrqlaypinklhkahyv
    lmnveapqevidelettfrfndavirsmvmrtkhavteasp
    

  • Chain 'G':
    Sequence, based on SEQRES records: (download)
    >2vhoG (G:)
    prrrvigqrkilpdpkfgsellakfvnilmvdgkkstaesivysaletlaqrsgkselea
    fevalenvrptvevksrrvggstyqvpvevrpvrrnalamrwiveaarkrgdksmalrla
    nelsdaaenkgtavkkredvhrmaeankafahyrwlslrsfshqagasskqpalgyln
    

    Sequence, based on observed residues (ATOM records): (download)
    >2vhoG (G:)
    rrrvigqrkilpdpkfgsellakfvnilmvdgkkstaesivysaletlaqrsgkseleaf
    evalenvrptvevksrrvggstyqvpvevrpvrrnalamrwiveaarkrgdksmalrlan
    elsdaaenkgtavkkredvhrmaeankafah
    

  • Chain 'H':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2vhoH (H:)
    smqdpiadmltrirngqaankaavtmpssklkvaianvlkeegfiedfkvegdtkpelel
    tlkyfqgkavvesiqrvsrpglriykrkdelpkvmaglgiavvstskgvmtdraarqagl
    ggeiicyva
    

  • Chain 'I':
    Sequence, based on SEQRES records: (download)
    >2vhoI (I:)
    aenqyygtgrrkssaarvfikpgngkivinqrsleqyfgretarmvvrqplelvdmvekl
    dlyitvkgggisgqagairhgitralmeydeslrselrkagfvtrdarqverkkvglrka
    rrrpqfskr
    

    Sequence, based on observed residues (ATOM records): (download)
    >2vhoI (I:)
    nqyygtgrrkssaarvfikpgngkivinqrsleqyfgretarmvvrqplelvdmvekldl
    yitvkgggisgqagairhgitralmeydeslrselrkagfvtrdarqverkkvglrkarr
    rpqfskr
    

  • Chain 'J':
    Sequence, based on SEQRES records: (download)
    >2vhoJ (J:)
    mqnqririrlkafdhrlidqataeivetakrtgaqvrgpiplptrkerftvlisphvnkd
    ardqyeirthlrlvdiveptektvdalmrldlaagvdvqislg
    

    Sequence, based on observed residues (ATOM records): (download)
    >2vhoJ (J:)
    ririrlkafdhrlidqataeivetakrtgaqvrgpiplptrkerftvlisphvnkdardq
    yeirthlrlvdiveptektvdalmrldlaagvdvqislg
    

  • Chain 'K':
    Sequence, based on SEQRES records: (download)
    >2vhoK (K:)
    akapirarkrvrkqvsdgvahihasfnntivtitdrqgnalgwataggsgfrgsrkstpf
    aaqvaaercadavkeygiknlevmvkgpgpgrestiralnaagfritnitdvtpiphngc
    rppkkrrv
    

    Sequence, based on observed residues (ATOM records): (download)
    >2vhoK (K:)
    rkqvsdgvahihasfnntivtitdrqgnalgwataggsgfrgsrkstpfaaqvaaercad
    avkeygiknlevmvkgpgpgrestiralnaagfritnitdvtpiphngcrppkkrrv
    

  • Chain 'L':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2vhoL (L:)
    atvnqlvrkprarkvaksnvpaleacpqkrgvctrvytttpkkpnsalrkvcrvrltngf
    evtsyiggeghnlqehsvilirggrvkdlpgvryhtvrgaldcsgvkdrkqarskygvkr
    pka
    

  • Chain 'M':
    Sequence, based on SEQRES records: (download)
    >2vhoM (M:)
    ariaginipdhkhavialtsiygvgktrskailaaagiaedvkiselsegqidtlrdeva
    kfvvegdlrreismsikrlmdlgcyrglrhrrglpvrgqrtktnartrkgprkpikk
    

    Sequence, based on observed residues (ATOM records): (download)
    >2vhoM (M:)
    ariaginipdhkhavialtsiygvgktrskailaaagiaedvkiselsegqidtlrdeva
    kfvvegdlrreismsikrlmdlgcyrglrhrrglpvrgqrtktnartrkgprkpi
    

  • Chain 'N':
    Sequence, based on SEQRES records: (download)
    >2vhoN (N:)
    akqsmkarevkrvaladkyfakraelkaiisdvnasdedrwnavlklqtlprdsspsrqr
    nrcrqtgrphgflrkfglsrikvreaamrgeipglkkasw
    

    Sequence, based on observed residues (ATOM records): (download)
    >2vhoN (N:)
    akqsmkarevkrvaladkyfakraelkaiisdvnarwnavlklqtlprdsspsrqrnrcr
    qtgrphgflrkfglsrikvreaamrgeipglkkasw
    

  • Chain 'O':
    Sequence, based on SEQRES records: (download)
    >2vhoO (O:)
    mslsteatakivsefgrdandtgstevqvalltaqinhlqghfaehkkdhhsrrgllrmv
    sqrrklldylkrkdvarytrlierlglrr
    

    Sequence, based on observed residues (ATOM records): (download)
    >2vhoO (O:)
    slsteatakivsefgrdandtgstevqvalltaqinhlqghfaehkkdhhsrrgllrmvs
    qrrklldylkrkdvarytrlierlglrr
    

  • Chain 'P':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2vhoP (P:)
    mvtirlarhgakkrpfyqvvvadsrnarngrfiervgffnpiasekeegtrldldriahw
    vgqgatisdrvaalikevnkaa
    

  • Chain 'Q':
    Sequence, based on SEQRES records: (download)
    >2vhoQ (Q:)
    tdkirtlqgrvvsdkmeksivvaierfvkhpiygkfikrttklhvhdennecgigdvvei
    recrplsktkswtlvrvvekavl
    

    Sequence, based on observed residues (ATOM records): (download)
    >2vhoQ (Q:)
    kirtlqgrvvsdkmeksivvaierfvkhpiygkfikrttklhvhdennecgigdvveire
    crplsktkswtlvrvvekavl
    

  • Chain 'R':
    Sequence, based on SEQRES records: (download)
    >2vhoR (R:)
    aryfrrrkfcrftaegvqeidykdiatlknyitesgkivpsritgtrakyqrqlaraikr
    arylsllpytdrhq
    

    Sequence, based on observed residues (ATOM records): (download)
    >2vhoR (R:)
    eidykdiatlknyitesgkivpsritgtrakyqrqlaraikrarylsllpytdrhq
    

  • Chain 'S':
    Sequence, based on SEQRES records: (download)
    >2vhoS (S:)
    prslkkgpfidlhllkkvekavesgdkkplrtwsrrstifpnmigltiavhngrqhvpvf
    vtdemvghklgefaptrtyrghaadkkakkk
    

    Sequence, based on observed residues (ATOM records): (download)
    >2vhoS (S:)
    rslkkgpfidlhllkkvekavesgdkkplrtwsrrstifpnmigltiavhngrqhvpvfv
    tdemvghklgefaptrtyrg
    

  • Chain 'T':
    Sequence, based on SEQRES records: (download)
    >2vhoT (T:)
    aniksakkraiqsekarkhnasrrsmmrtfikkvyaaieagdkaaaqkafnemqpivdrq
    aakglihknkaarhkanltaqinkla
    

    Sequence, based on observed residues (ATOM records): (download)
    >2vhoT (T:)
    niksakkraiqsekarkhnasrrsmmrtfikkvyaaieagdkaaaqkafnemqpivdrqa
    akglihknkaarhkanltaqinkla
    

  • Chain 'U':
    Sequence, based on SEQRES records: (download)
    >2vhoU (U:)
    mpvikvrenepfdvalrrfkrscekagvlaevrrrefyekptterkrakasavkrhakkl
    arenarrtrly
    

    Sequence, based on observed residues (ATOM records): (download)
    >2vhoU (U:)
    ikvrenepfdvalrrfkrscekagvlaevrrrefyekptterkrakasavkr