Structural Classification of Proteins and ASTRAL release 1.75B (January 2013)
Search SCOP (example):

Lineage for d2v4je3 (2v4j E:136-208,E:278-381)

  1. Root: SCOP 1.75B
  2. Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. Fold d.134: Nitrite and sulphite reductase 4Fe-4S domain-like [56013] (1 superfamily)
    beta-alpha-beta-alpha-beta(3)-alpha(2,3); mixed sheet: order 12345; left-handed crossover connection between strands 1 and 2
  4. Superfamily d.134.1: Nitrite and sulphite reductase 4Fe-4S domain-like [56014] (1 family) (S)
    duplication: contains two domains of this fold
  5. Family d.134.1.1: Nitrite and sulphite reductase 4Fe-4S domain-like [56015] (5 protein domains)
  6. Protein Dissimilatory sulfite reductase subunit beta, DsrB [160772] (2 species)
  7. Species Desulfovibrio vulgaris [TaxId:881] [160773] (1 PDB entry)
    Uniprot P45575 136-208,278-381
  8. Domain d2v4je3: 2v4j E:136-208,E:278-381 [152568]
    Other proteins in same PDB: d2v4ja1, d2v4ja2, d2v4ja3, d2v4jb1, d2v4jb2, d2v4jc1, d2v4jd1, d2v4jd2, d2v4jd3, d2v4je1, d2v4je2, d2v4jf_
    automatically matched to 2V4J B:136-208,B:278-381
    complexed with sf4, so3, srm

Details for d2v4je3

PDB Entry: 2v4j (more details)
PDB Description: the crystal structure of desulfovibrio vulgaris dissimilatory sulfite reductase bound to dsrc provides novel insights into the mechanism of sulfate respiration
PDB Compounds: (E:) sulfite reductase, dissimilatory-type subunit beta

SCOP Domain Sequences for d2v4je3:

Sequence; same for both SEQRES and ATOM records: (download)

>d2v4je3 d.134.1.1 (E:136-208,E:278-381) Dissimilatory sulfite reductase subunit beta, DsrB {Desulfovibrio vulgaris [TaxId: 881]}
gagvsnivhtqgwvhchtpatdasgpvkaimdevfedfqsmrlpapvrislaccinmcga
vhcsdigvvgihrXgdgvvimvggkvsnrismpkfskvvvayipnepprwpsltktikhi
ievysanaykyerlgewaerigwerffsltglefshhliddfrdpayytwrqstqfkf

SCOP Domain Coordinates for d2v4je3:

Click to download the PDB-style file with coordinates for d2v4je3.
(The format of our PDB-style files is described here.)

Timeline for d2v4je3:

d2v4je3 appears in SCOP 1.75A


d2v4je3
(click for larger image)


d2v4je3 in context of chain
Domains from same chain:
d2v4je1, d2v4je2


d2v4je3 in context of PDB
Domains from other chains:
d2v4ja1, d2v4ja2, d2v4ja3, d2v4jb1, d2v4jb2, d2v4jb3, d2v4jc1, d2v4jd1, d2v4jd2, d2v4jd3, d2v4jf_

SCOP Copyright © 1994-2013 The SCOP and Astral authors
scop@mrc-lmb.cam.ac.uk and astral@compbio.berkeley.edu