Lineage for d2v4je3 (2v4j E:136-208,E:278-381)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2977656Fold d.134: Nitrite and sulphite reductase 4Fe-4S domain-like [56013] (1 superfamily)
    beta-alpha-beta-alpha-beta(3)-alpha(2,3); mixed sheet: order 12345; left-handed crossover connection between strands 1 and 2
  4. 2977657Superfamily d.134.1: Nitrite and sulphite reductase 4Fe-4S domain-like [56014] (2 families) (S)
    duplication: contains two domains of this fold
  5. 2977658Family d.134.1.1: Nitrite and sulphite reductase 4Fe-4S domain-like [56015] (5 proteins)
  6. 2977680Protein Dissimilatory sulfite reductase subunit beta, DsrB [160772] (2 species)
  7. 2977700Species Desulfovibrio vulgaris [TaxId:881] [160773] (1 PDB entry)
    Uniprot P45575 136-208,278-381
  8. 2977702Domain d2v4je3: 2v4j E:136-208,E:278-381 [152568]
    Other proteins in same PDB: d2v4ja1, d2v4ja2, d2v4ja3, d2v4jb1, d2v4jb2, d2v4jc1, d2v4jd1, d2v4jd2, d2v4jd3, d2v4je1, d2v4je2, d2v4jf_
    automated match to d2v4jb3
    complexed with sf4, sh0, so3, srm

Details for d2v4je3

PDB Entry: 2v4j (more details), 2.1 Å

PDB Description: the crystal structure of desulfovibrio vulgaris dissimilatory sulfite reductase bound to dsrc provides novel insights into the mechanism of sulfate respiration
PDB Compounds: (E:) sulfite reductase, dissimilatory-type subunit beta

SCOPe Domain Sequences for d2v4je3:

Sequence; same for both SEQRES and ATOM records: (download)

>d2v4je3 d.134.1.1 (E:136-208,E:278-381) Dissimilatory sulfite reductase subunit beta, DsrB {Desulfovibrio vulgaris [TaxId: 881]}
gagvsnivhtqgwvhchtpatdasgpvkaimdevfedfqsmrlpapvrislaccinmcga
vhcsdigvvgihrXgdgvvimvggkvsnrismpkfskvvvayipnepprwpsltktikhi
ievysanaykyerlgewaerigwerffsltglefshhliddfrdpayytwrqstqfkf

SCOPe Domain Coordinates for d2v4je3:

Click to download the PDB-style file with coordinates for d2v4je3.
(The format of our PDB-style files is described here.)

Timeline for d2v4je3: