PDB entry 2v4j

View 2v4j on RCSB PDB site
Description: THE CRYSTAL STRUCTURE OF Desulfovibrio vulgaris DISSIMILATORY SULFITE REDUCTASE BOUND TO DsrC PROVIDES NOVEL INSIGHTS INTO THE MECHANISM OF SULFATE RESPIRATION
Class: oxidoreductase
Keywords: dissimilatory sulfite reductase, siroheme, oxidoreductase, sirohydrochlorin
Deposited on 2008-09-22, released 2008-09-30
The last revision prior to the SCOPe 2.08 freeze date was dated 2014-07-16, with a file datestamp of 2014-07-11.
Experiment type: XRAY
Resolution: 2.1 Å
R-factor: 0.1916
AEROSPACI score: 0.33 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: sulfite reductase, dissimilatory-type subunit alpha
    Species: DESULFOVIBRIO VULGARIS [TaxId:882]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d2v4ja1, d2v4ja2, d2v4ja3
  • Chain 'B':
    Compound: sulfite reductase, dissimilatory-type subunit beta
    Species: DESULFOVIBRIO VULGARIS [TaxId:882]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d2v4jb1, d2v4jb2, d2v4jb3
  • Chain 'C':
    Compound: sulfite reductase, dissimilatory-type subunit gamma
    Species: DESULFOVIBRIO VULGARIS [TaxId:882]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d2v4jc1
  • Chain 'D':
    Compound: sulfite reductase, dissimilatory-type subunit alpha
    Species: DESULFOVIBRIO VULGARIS [TaxId:882]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d2v4jd1, d2v4jd2, d2v4jd3
  • Chain 'E':
    Compound: sulfite reductase, dissimilatory-type subunit beta
    Species: DESULFOVIBRIO VULGARIS [TaxId:882]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d2v4je1, d2v4je2, d2v4je3
  • Chain 'F':
    Compound: sulfite reductase, dissimilatory-type subunit gamma
    Species: DESULFOVIBRIO VULGARIS [TaxId:882]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d2v4jf_
  • Heterogens: SF4, SH0, SRM, SO3, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2v4jA (A:)
    makhatpkldqlesgpwpsfvsdikqeaayraanpkgldyqvpvdcpedllgvlelsyde
    gethwkhggivgvfgygggvigrycdqpekfpgvahfhtvrvaqpsgkyysadylrqlcd
    iwdlrgsgltnmhgstgdivllgtqtpqleeiffelthnlntdlggsgsnlrtpesclgk
    srcefacydsqaacyeltmeyqdelhrpafpykfkfkfdacpngcvasiarsdfsvigtw
    kddikidaeavkayvagefkpnagahsgrdwgkfdieaevvnrcpskcmkwdgsklsidn
    kecvrcmhcintmpralhigdergasilcgakapildgaqmgsllvpfvaaeepfdeike
    vvekiwdwwmeegknrerlgetmkrlsfqkllevteiapvpqhvkeprtnpyiffkeeev
    pggwdrditeyrkrhlr
    

    Sequence, based on observed residues (ATOM records): (download)
    >2v4jA (A:)
    akhatpkldqlesgpwpsfvsdikqeaayraanpkgldyqvpvdcpedllgvlelsydeg
    ethwkhggivgvfgygggvigrycdqpekfpgvahfhtvrvaqpsgkyysadylrqlcdi
    wdlrgsgltnmhgstgdivllgtqtpqleeiffelthnlntdlggsgsnlrtpesclgks
    rcefacydsqaacyeltmeyqdelhrpafpykfkfkfdacpngcvasiarsdfsvigtwk
    ddikidaeavkayvagefkpnagahsgrdwgkfdieaevvnrcpskcmkwdgsklsidnk
    ecvrcmhcintmpralhigdergasilcgakapildgaqmgsllvpfvaaeepfdeikev
    vekiwdwwmeegknrerlgetmkrlsfqkllevteiapvpqhvkeprtnpyiffkeeevp
    ggwdrditeyrkrhlr
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2v4jB (B:)
    mafissgynpekpmanritdigprkfdeffppviaknfgswlyheilepgvlmhvaesgd
    kvytvrvgaarlmsithiremcdiadkycgghlrfttrnnvefmvadeaslkalkedlas
    rkfdggslkfpiggtgagvsnivhtqgwvhchtpatdasgpvkaimdevfedfqsmrlpa
    pvrislaccinmcgavhcsdigvvgihrkppmidhewtdqlceiplavascptaavrptk
    leigdkkvntiaiknercmycgncytmcpalpisdgegdgvvimvggkvsnrismpkfsk
    vvvayipnepprwpsltktikhiievysanaykyerlgewaerigwerffsltglefshh
    liddfrdpayytwrqstqfkf
    

    Sequence, based on observed residues (ATOM records): (download)
    >2v4jB (B:)
    afissgynpekpmanritdigprkfdeffppviaknfgswlyheilepgvlmhvaesgdk
    vytvrvgaarlmsithiremcdiadkycgghlrfttrnnvefmvadeaslkalkedlasr
    kfdggslkfpiggtgagvsnivhtqgwvhchtpatdasgpvkaimdevfedfqsmrlpap
    vrislaccinmcgavhcsdigvvgihrkppmidhewtdqlceiplavascptaavrptkl
    eigdkkvntiaiknercmycgncytmcpalpisdgegdgvvimvggkvsnrismpkfskv
    vvayipnepprwpsltktikhiievysanaykyerlgewaerigwerffsltglefshhl
    iddfrdpayytwrqstqfkf
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >2v4jC (C:)
    maevtykgksfevdedgfllrfddwcpewveyvkesegisdispdhqkiidflqdyykkn
    giapmvrilskntgfklkevyelfpsgpgkgackmaglpkptgcv
    

    Sequence, based on observed residues (ATOM records): (download)
    >2v4jC (C:)
    evtykgksfevdedgfllrfddwcpewveyvkesegisdispdhqkiidflqdyykkngi
    apmvrilskntgfklkevyelfpsgpgkgackmaglpkptgcv
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >2v4jD (D:)
    makhatpkldqlesgpwpsfvsdikqeaayraanpkgldyqvpvdcpedllgvlelsyde
    gethwkhggivgvfgygggvigrycdqpekfpgvahfhtvrvaqpsgkyysadylrqlcd
    iwdlrgsgltnmhgstgdivllgtqtpqleeiffelthnlntdlggsgsnlrtpesclgk
    srcefacydsqaacyeltmeyqdelhrpafpykfkfkfdacpngcvasiarsdfsvigtw
    kddikidaeavkayvagefkpnagahsgrdwgkfdieaevvnrcpskcmkwdgsklsidn
    kecvrcmhcintmpralhigdergasilcgakapildgaqmgsllvpfvaaeepfdeike
    vvekiwdwwmeegknrerlgetmkrlsfqkllevteiapvpqhvkeprtnpyiffkeeev
    pggwdrditeyrkrhlr
    

    Sequence, based on observed residues (ATOM records): (download)
    >2v4jD (D:)
    akhatpkldqlesgpwpsfvsdikqeaayraanpkgldyqvpvdcpedllgvlelsydeg
    ethwkhggivgvfgygggvigrycdqpekfpgvahfhtvrvaqpsgkyysadylrqlcdi
    wdlrgsgltnmhgstgdivllgtqtpqleeiffelthnlntdlggsgsnlrtpesclgks
    rcefacydsqaacyeltmeyqdelhrpafpykfkfkfdacpngcvasiarsdfsvigtwk
    ddikidaeavkayvagefkpnagahsgrdwgkfdieaevvnrcpskcmkwdgsklsidnk
    ecvrcmhcintmpralhigdergasilcgakapildgaqmgsllvpfvaaeepfdeikev
    vekiwdwwmeegknrerlgetmkrlsfqkllevteiapvpqhvkeprtnpyiffkeeevp
    ggwdrditeyrkrhlr
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >2v4jE (E:)
    mafissgynpekpmanritdigprkfdeffppviaknfgswlyheilepgvlmhvaesgd
    kvytvrvgaarlmsithiremcdiadkycgghlrfttrnnvefmvadeaslkalkedlas
    rkfdggslkfpiggtgagvsnivhtqgwvhchtpatdasgpvkaimdevfedfqsmrlpa
    pvrislaccinmcgavhcsdigvvgihrkppmidhewtdqlceiplavascptaavrptk
    leigdkkvntiaiknercmycgncytmcpalpisdgegdgvvimvggkvsnrismpkfsk
    vvvayipnepprwpsltktikhiievysanaykyerlgewaerigwerffsltglefshh
    liddfrdpayytwrqstqfkf
    

    Sequence, based on observed residues (ATOM records): (download)
    >2v4jE (E:)
    afissgynpekpmanritdigprkfdeffppviaknfgswlyheilepgvlmhvaesgdk
    vytvrvgaarlmsithiremcdiadkycgghlrfttrnnvefmvadeaslkalkedlasr
    kfdggslkfpiggtgagvsnivhtqgwvhchtpatdasgpvkaimdevfedfqsmrlpap
    vrislaccinmcgavhcsdigvvgihrkppmidhewtdqlceiplavascptaavrptkl
    eigdkkvntiaiknercmycgncytmcpalpisdgegdgvvimvggkvsnrismpkfskv
    vvayipnepprwpsltktikhiievysanaykyerlgewaerigwerffsltglefshhl
    iddfrdpayytwrqstqfkf
    

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >2v4jF (F:)
    maevtykgksfevdedgfllrfddwcpewveyvkesegisdispdhqkiidflqdyykkn
    giapmvrilskntgfklkevyelfpsgpgkgackmaglpkptgcv
    

    Sequence, based on observed residues (ATOM records): (download)
    >2v4jF (F:)
    evtykgksfevdedgfllrfddwcpewveyvkesegisdispdhqkiidflqdyykkngi
    apmvrilskntgfklkevyelfpsgpgkgackmaglpkptgcv