![]() | Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
![]() | Fold d.134: Nitrite and sulphite reductase 4Fe-4S domain-like [56013] (1 superfamily) beta-alpha-beta-alpha-beta(3)-alpha(2,3); mixed sheet: order 12345; left-handed crossover connection between strands 1 and 2 |
![]() | Superfamily d.134.1: Nitrite and sulphite reductase 4Fe-4S domain-like [56014] (2 families) ![]() duplication: contains two domains of this fold |
![]() | Family d.134.1.1: Nitrite and sulphite reductase 4Fe-4S domain-like [56015] (5 proteins) |
![]() | Protein Dissimilatory sulfite reductase subunit alpha, DsrA [160777] (2 species) |
![]() | Species Desulfovibrio vulgaris [TaxId:881] [160778] (1 PDB entry) Uniprot P45574 168-241,323-437 |
![]() | Domain d2v4ja3: 2v4j A:168-241,A:323-437 [152558] Other proteins in same PDB: d2v4ja1, d2v4ja2, d2v4jb1, d2v4jb2, d2v4jb3, d2v4jc1, d2v4jd1, d2v4jd2, d2v4je1, d2v4je2, d2v4je3, d2v4jf_ complexed with sf4, sh0, so3, srm |
PDB Entry: 2v4j (more details), 2.1 Å
SCOPe Domain Sequences for d2v4ja3:
Sequence; same for both SEQRES and ATOM records: (download)
>d2v4ja3 d.134.1.1 (A:168-241,A:323-437) Dissimilatory sulfite reductase subunit alpha, DsrA {Desulfovibrio vulgaris [TaxId: 881]} gsnlrtpesclgksrcefacydsqaacyeltmeyqdelhrpafpykfkfkfdacpngcva siarsdfsvigtwkXrgasilcgakapildgaqmgsllvpfvaaeepfdeikevvekiwd wwmeegknrerlgetmkrlsfqkllevteiapvpqhvkeprtnpyiffkeeevpggwdrd iteyrkrhlr
Timeline for d2v4ja3: