Lineage for d2v4jc1 (2v4j C:3-105)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 3006154Fold d.203: DsrC, the gamma subunit of dissimilatory sulfite reductase [69720] (1 superfamily)
    beta(3)-alpha(5); meander beta-sheet packed against array of helices
  4. 3006155Superfamily d.203.1: DsrC, the gamma subunit of dissimilatory sulfite reductase [69721] (2 families) (S)
  5. 3006156Family d.203.1.1: DsrC, the gamma subunit of dissimilatory sulfite reductase [69722] (2 proteins)
    automatically mapped to Pfam PF04358
  6. 3006157Protein DsrC, the gamma subunit of dissimilatory sulfite reductase [69723] (4 species)
  7. 3006165Species Desulfovibrio vulgaris [TaxId:881] [160276] (1 PDB entry)
    Uniprot P45573 3-105
  8. 3006166Domain d2v4jc1: 2v4j C:3-105 [152562]
    Other proteins in same PDB: d2v4ja1, d2v4ja2, d2v4ja3, d2v4jb1, d2v4jb2, d2v4jb3, d2v4jd1, d2v4jd2, d2v4jd3, d2v4je1, d2v4je2, d2v4je3, d2v4jf_
    complexed with sf4, sh0, so3, srm

Details for d2v4jc1

PDB Entry: 2v4j (more details), 2.1 Å

PDB Description: the crystal structure of desulfovibrio vulgaris dissimilatory sulfite reductase bound to dsrc provides novel insights into the mechanism of sulfate respiration
PDB Compounds: (C:) sulfite reductase, dissimilatory-type subunit gamma

SCOPe Domain Sequences for d2v4jc1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2v4jc1 d.203.1.1 (C:3-105) DsrC, the gamma subunit of dissimilatory sulfite reductase {Desulfovibrio vulgaris [TaxId: 881]}
evtykgksfevdedgfllrfddwcpewveyvkesegisdispdhqkiidflqdyykkngi
apmvrilskntgfklkevyelfpsgpgkgackmaglpkptgcv

SCOPe Domain Coordinates for d2v4jc1:

Click to download the PDB-style file with coordinates for d2v4jc1.
(The format of our PDB-style files is described here.)

Timeline for d2v4jc1: