![]() | Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
![]() | Fold d.58: Ferredoxin-like [54861] (62 superfamilies) alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2 |
![]() | Superfamily d.58.1: 4Fe-4S ferredoxins [54862] (7 families) ![]() |
![]() | Family d.58.1.5: Ferredoxin domains from multidomain proteins [54884] (14 proteins) members of this "family" may be more closely related to other ferredoxins than to each other in the multi-domain class (e), this applies to domains with different numbers of (sub)domains than the most common domain |
![]() | Protein DsrA insert domain [160280] (2 species) |
![]() | Species Desulfovibrio vulgaris [TaxId:881] [160281] (1 PDB entry) Uniprot P45574 242-322 |
![]() | Domain d2v4jd1: 2v4j D:242-322 [152563] Other proteins in same PDB: d2v4ja2, d2v4ja3, d2v4jb1, d2v4jb2, d2v4jb3, d2v4jc1, d2v4jd2, d2v4jd3, d2v4je1, d2v4je2, d2v4je3, d2v4jf_ automated match to d2v4ja1 complexed with sf4, sh0, so3, srm |
PDB Entry: 2v4j (more details), 2.1 Å
SCOPe Domain Sequences for d2v4jd1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2v4jd1 d.58.1.5 (D:242-322) DsrA insert domain {Desulfovibrio vulgaris [TaxId: 881]} ddikidaeavkayvagefkpnagahsgrdwgkfdieaevvnrcpskcmkwdgsklsidnk ecvrcmhcintmpralhigde
Timeline for d2v4jd1: