Lineage for d2v4jf_ (2v4j F:)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 3006154Fold d.203: DsrC, the gamma subunit of dissimilatory sulfite reductase [69720] (1 superfamily)
    beta(3)-alpha(5); meander beta-sheet packed against array of helices
  4. 3006155Superfamily d.203.1: DsrC, the gamma subunit of dissimilatory sulfite reductase [69721] (2 families) (S)
  5. 3006178Family d.203.1.0: automated matches [191358] (1 protein)
    not a true family
  6. 3006179Protein automated matches [190408] (1 species)
    not a true protein
  7. 3006180Species Desulfovibrio vulgaris [TaxId:882] [187285] (1 PDB entry)
  8. 3006181Domain d2v4jf_: 2v4j F: [152569]
    Other proteins in same PDB: d2v4ja1, d2v4ja2, d2v4ja3, d2v4jb1, d2v4jb2, d2v4jb3, d2v4jc1, d2v4jd1, d2v4jd2, d2v4jd3, d2v4je1, d2v4je2, d2v4je3
    automated match to d1ji8a_
    complexed with sf4, sh0, so3, srm

Details for d2v4jf_

PDB Entry: 2v4j (more details), 2.1 Å

PDB Description: the crystal structure of desulfovibrio vulgaris dissimilatory sulfite reductase bound to dsrc provides novel insights into the mechanism of sulfate respiration
PDB Compounds: (F:) sulfite reductase, dissimilatory-type subunit gamma

SCOPe Domain Sequences for d2v4jf_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2v4jf_ d.203.1.0 (F:) automated matches {Desulfovibrio vulgaris [TaxId: 882]}
evtykgksfevdedgfllrfddwcpewveyvkesegisdispdhqkiidflqdyykkngi
apmvrilskntgfklkevyelfpsgpgkgackmaglpkptgcv

SCOPe Domain Coordinates for d2v4jf_:

Click to download the PDB-style file with coordinates for d2v4jf_.
(The format of our PDB-style files is described here.)

Timeline for d2v4jf_: