| Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
| Fold d.203: DsrC, the gamma subunit of dissimilatory sulfite reductase [69720] (1 superfamily) beta(3)-alpha(5); meander beta-sheet packed against array of helices |
Superfamily d.203.1: DsrC, the gamma subunit of dissimilatory sulfite reductase [69721] (2 families) ![]() |
| Family d.203.1.0: automated matches [191358] (1 protein) not a true family |
| Protein automated matches [190408] (1 species) not a true protein |
| Species Desulfovibrio vulgaris [TaxId:882] [187285] (1 PDB entry) |
| Domain d2v4jf_: 2v4j F: [152569] Other proteins in same PDB: d2v4ja1, d2v4ja2, d2v4ja3, d2v4jb1, d2v4jb2, d2v4jb3, d2v4jc1, d2v4jd1, d2v4jd2, d2v4jd3, d2v4je1, d2v4je2, d2v4je3 automated match to d1ji8a_ complexed with sf4, sh0, so3, srm |
PDB Entry: 2v4j (more details), 2.1 Å
SCOPe Domain Sequences for d2v4jf_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2v4jf_ d.203.1.0 (F:) automated matches {Desulfovibrio vulgaris [TaxId: 882]}
evtykgksfevdedgfllrfddwcpewveyvkesegisdispdhqkiidflqdyykkngi
apmvrilskntgfklkevyelfpsgpgkgackmaglpkptgcv
Timeline for d2v4jf_: