SCOPe 2.08: Domain d2v33a_: 2v33 A:

Lineage for d2v33a_ (2v33 A:)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.18: E set domains [81296] (27 families)
   "Early" Ig-like fold families possibly related to the immunoglobulin and/or fibronectin type III superfamilies

5. Family b.1.18.4: Class II viral fusion proteins C-terminal domain [81284] (3 proteins)

6. Protein Fusion glycoprotein E1 [74840] (1 species)

7. Species Semliki forest virus [TaxId:11033] [74841] (3 PDB entries)

8. Domain d2v33a_: 2v33 A: [152439]
   automated match to d2v33a1
   complexed with no3

Details for d2v33a_

PDB Entry: 2v33, 1.55 Å

PDB Description: high resolution crystal structure of domain iii of e1 fusion glycoprotein of semliki forest virus

PDB Compounds: (A:) e1 envelope glycoprotein

SCOPe Domain Sequences for d2v33a_:

Sequence; same for both SEQRES and ATOM records:

>d2v33a_ b.1.18.4 (A:) Fusion glycoprotein E1 {Semliki forest virus [TaxId: 11033]}
eaptiidltctvatcthssdfggvltltyktnkngdcsvhshsnvatlqeatakvktagk
vtlhfstasaspsfvvslcsaratcsascep

Timeline for d2v33a_:

• d2v33a_ first appeared in SCOP 1.75, called d2v33a1
  
• d2v33a_ appears in SCOPe 2.07