PDB entry 2v33

View 2v33 on RCSB PDB site
Description: High resolution crystal structure of domain III of E1 fusion glycoprotein of Semliki Forest Virus
Class: viral protein
Keywords: glycoprotein, transmembrane, viral protein
Deposited on 2007-06-11, released 2008-07-22
The last revision prior to the SCOPe 2.08 freeze date was dated 2019-01-30, with a file datestamp of 2019-01-25.
Experiment type: XRAY
Resolution: 1.55 Å
R-factor: N/A
AEROSPACI score: 0.45 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: e1 envelope glycoprotein
    Species: SEMLIKI FOREST VIRUS [TaxId:11033]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d2v33a_
  • Chain 'B':
    Compound: e1 envelope glycoprotein
    Species: SEMLIKI FOREST VIRUS [TaxId:11033]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d2v33b_
  • Heterogens: NO3, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2v33A (A:)
    eaptiidltctvatcthssdfggvltltyktnkngdcsvhshsnvatlqeatakvktagk
    vtlhfstasaspsfvvslcsaratcsascep
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2v33B (B:)
    eaptiidltctvatcthssdfggvltltyktnkngdcsvhshsnvatlqeatakvktagk
    vtlhfstasaspsfvvslcsaratcsascep