SCOP 1.75: Domain d2v33a1: 2v33 A:293-382

Lineage for d2v33a1 (2v33 A:293-382)

1. Root: SCOP 1.75

2. Class b: All beta proteins [48724] (174 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (28 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.18: E set domains [81296] (23 families)
   "Early" Ig-like fold families possibly related to the immunoglobulin and/or fibronectin type III superfamilies

5. Family b.1.18.4: Class II viral fusion proteins C-terminal domain [81284] (2 proteins)

6. Protein Fusion glycoprotein E1 [74840] (1 species)

7. Species Semliki forest virus [TaxId:11033] [74841] (4 PDB entries)

8. Domain d2v33a1: 2v33 A:293-382 [152439]
   automatically matched to d1rera1
   complexed with no3

Details for d2v33a1

PDB Entry: 2v33, 1.55 Å

PDB Description: high resolution crystal structure of domain iii of e1 fusion glycoprotein of semliki forest virus

PDB Compounds: (A:) e1 envelope glycoprotein

SCOP Domain Sequences for d2v33a1:

Sequence; same for both SEQRES and ATOM records:

>d2v33a1 b.1.18.4 (A:293-382) Fusion glycoprotein E1 {Semliki forest virus [TaxId: 11033]}
aptiidltctvatcthssdfggvltltyktnkngdcsvhshsnvatlqeatakvktagkv
tlhfstasaspsfvvslcsaratcsascep

Timeline for d2v33a1:

• d2v33a1 is new in SCOP 1.75
  
• d2v33a1 is called d2v33a_ in SCOPe 2.01
  
• d2v33a1 appears in the current release, SCOPe 2.08, called d2v33a_