Lineage for d2v33b_ (2v33 B:)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2739517Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2765063Superfamily b.1.18: E set domains [81296] (27 families) (S)
    "Early" Ig-like fold families possibly related to the immunoglobulin and/or fibronectin type III superfamilies
  5. 2765451Family b.1.18.4: Class II viral fusion proteins C-terminal domain [81284] (3 proteins)
  6. 2765487Protein Fusion glycoprotein E1 [74840] (1 species)
  7. 2765488Species Semliki forest virus [TaxId:11033] [74841] (3 PDB entries)
  8. 2765490Domain d2v33b_: 2v33 B: [152440]
    automated match to d2v33a1
    complexed with no3

Details for d2v33b_

PDB Entry: 2v33 (more details), 1.55 Å

PDB Description: high resolution crystal structure of domain iii of e1 fusion glycoprotein of semliki forest virus
PDB Compounds: (B:) e1 envelope glycoprotein

SCOPe Domain Sequences for d2v33b_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2v33b_ b.1.18.4 (B:) Fusion glycoprotein E1 {Semliki forest virus [TaxId: 11033]}
eaptiidltctvatcthssdfggvltltyktnkngdcsvhshsnvatlqeatakvktagk
vtlhfstasaspsfvvslcsaratcsascep

SCOPe Domain Coordinates for d2v33b_:

Click to download the PDB-style file with coordinates for d2v33b_.
(The format of our PDB-style files is described here.)

Timeline for d2v33b_: