SCOPe 2.08: Domain d2rdzb_: 2rdz B:

Lineage for d2rdzb_ (2rdz B:)

1. Root: SCOPe 2.08

2. Class a: All alpha proteins [46456] (290 folds)

3. Fold a.138: Multiheme cytochromes [48694] (1 superfamily)
   variable number of helices and little beta structure; not a true fold
   annotated by the SCOP(e) curators as 'not a true fold'

4. Superfamily a.138.1: Multiheme cytochromes [48695] (4 families)
   duplication: contains multiple CxxCH motifs

5. Family a.138.1.3: Di-heme elbow motif [48711] (8 proteins)
   the main characteristic feature of this motif is the packing of its two hemes
   many members contains one or more complete motifs flanked by incomplete motifs and/or other domains

6. Protein automated matches [190276] (12 species)
   not a true protein

7. Species Escherichia coli [TaxId:562] [187218] (2 PDB entries)

8. Domain d2rdzb_: 2rdz B: [151968]
   automated match to d1gu6a_
   complexed with ca, edo, hec, so4

Details for d2rdzb_

PDB Entry: 2rdz, 1.74 Å

PDB Description: high resolution crystal structure of the escherichia coli cytochrome c nitrite reductase.

PDB Compounds: (B:) Cytochrome c-552

SCOPe Domain Sequences for d2rdzb_:

Sequence; same for both SEQRES and ATOM records:

>d2rdzb_ a.138.1.3 (B:) automated matches {Escherichia coli [TaxId: 562]}
tveaknetfapqhpdqylswkatseqservdalaedprlvilwagypfsrdynkprghaf
avtdvretlrtgapknaedgplpmacwsckspdvarliqkdgedgyfhgkwarggpeivn
nlgcadchntaspefakgkpeltlsrpyaarameaigkpfekagrfdqqsmvcgqchvey
yfdgknkavkfpwddgmkvenmeqyydkiafsdwtnslsktpmlkaqhpeyetwtagihg
knnvtcidchmpkvqnaegklytdhkignpfdnfaqtcanchtqdkaalqkvvaerkqsi
ndlkikvedqlvhahfeakaaldagateaemkpiqddirhaqwrwdlaiashgihmhape
eglrmlgtamdkaadartklarllatkgitheiqipdistkekaqqaiglnmeqikaekq
dfiktvipqweeqarknglls

Timeline for d2rdzb_:

• d2rdzb_ first appeared in SCOP 1.75, called d2rdzb1
  
• d2rdzb_ appears in SCOPe 2.07