SCOP 1.75: Domain d2rdzb1: 2rdz B:38-477

Lineage for d2rdzb1 (2rdz B:38-477)

1. Root: SCOP 1.75

2. Class a: All alpha proteins [46456] (284 folds)

3. Fold a.138: Multiheme cytochromes [48694] (1 superfamily)
   variable number of helices and little beta structure; not a true fold

4. Superfamily a.138.1: Multiheme cytochromes [48695] (3 families)
   duplication: contains multiple CxxCH motifs

5. Family a.138.1.3: Di-heme elbow motif [48711] (7 proteins)
   the main characteristic feature of this motif is the packing of its two hemes
   many members contains one or more complete motifs flanked by incomplete motifs and/or other domains

6. Protein Cytochrome c nitrite reductase [48718] (4 species)

7. Species Escherichia coli [TaxId:562] [74807] (2 PDB entries)

8. Domain d2rdzb1: 2rdz B:38-477 [151968]
   automatically matched to d1gu6a_
   complexed with ca, edo, hec, so4

Details for d2rdzb1

PDB Entry: 2rdz, 1.74 Å

PDB Description: high resolution crystal structure of the escherichia coli cytochrome c nitrite reductase.

PDB Compounds: (B:) Cytochrome c-552

SCOP Domain Sequences for d2rdzb1:

Sequence; same for both SEQRES and ATOM records:

>d2rdzb1 a.138.1.3 (B:38-477) Cytochrome c nitrite reductase {Escherichia coli [TaxId: 562]}
veaknetfapqhpdqylswkatseqservdalaedprlvilwagypfsrdynkprghafa
vtdvretlrtgapknaedgplpmacwsckspdvarliqkdgedgyfhgkwarggpeivnn
lgcadchntaspefakgkpeltlsrpyaarameaigkpfekagrfdqqsmvcgqchveyy
fdgknkavkfpwddgmkvenmeqyydkiafsdwtnslsktpmlkaqhpeyetwtagihgk
nnvtcidchmpkvqnaegklytdhkignpfdnfaqtcanchtqdkaalqkvvaerkqsin
dlkikvedqlvhahfeakaaldagateaemkpiqddirhaqwrwdlaiashgihmhapee
glrmlgtamdkaadartklarllatkgitheiqipdistkekaqqaiglnmeqikaekqd
fiktvipqweeqarknglls

Timeline for d2rdzb1:

• d2rdzb1 is new in SCOP 1.75
  
• d2rdzb1 is called d2rdzb_ in SCOPe 2.01
  
• d2rdzb1 appears in the current release, SCOPe 2.08, called d2rdzb_