Class g: Small proteins [56992] (100 folds) |
Fold g.17: Cystine-knot cytokines [57500] (1 superfamily) disulfide-rich fold; common core is all-beta |
Superfamily g.17.1: Cystine-knot cytokines [57501] (8 families) |
Family g.17.1.1: Platelet-derived growth factor-like [57502] (4 proteins) |
Protein Vascular endothelial growth factor, VEGF [57505] (3 species) |
Species Human (Homo sapiens) [TaxId:9606] [57506] (22 PDB entries) Uniprot P15692 40-133 |
Domain d2qr0j1: 2qr0 J:13-107 [151249] Other proteins in same PDB: d2qr0a1, d2qr0a2, d2qr0b1, d2qr0b2, d2qr0e1, d2qr0e2, d2qr0f1, d2qr0f2, d2qr0g1, d2qr0g2, d2qr0h1, d2qr0h2, d2qr0k1, d2qr0k2, d2qr0l1, d2qr0l2, d2qr0m1, d2qr0m2, d2qr0n1, d2qr0n2, d2qr0q1, d2qr0q2, d2qr0r1, d2qr0r2, d2qr0s1, d2qr0s2, d2qr0t1, d2qr0t2, d2qr0w1, d2qr0w2, d2qr0x1, d2qr0x2 automatically matched to d1katv_ |
PDB Entry: 2qr0 (more details), 3.5 Å
SCOPe Domain Sequences for d2qr0j1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2qr0j1 g.17.1.1 (J:13-107) Vascular endothelial growth factor, VEGF {Human (Homo sapiens) [TaxId: 9606]} evvkfmdvyqrsychpietlvdifqeypdeieyifkpscvplmrcggccndeglecvpte esnitmqimrikphqgqhigemsflqhnkcecrpk
Timeline for d2qr0j1:
View in 3D Domains from other chains: (mouse over for more information) d2qr0a1, d2qr0a2, d2qr0b1, d2qr0b2, d2qr0c1, d2qr0d1, d2qr0e1, d2qr0e2, d2qr0f1, d2qr0f2, d2qr0g1, d2qr0g2, d2qr0h1, d2qr0h2, d2qr0i1, d2qr0k1, d2qr0k2, d2qr0l1, d2qr0l2, d2qr0m1, d2qr0m2, d2qr0n1, d2qr0n2, d2qr0o1, d2qr0p1, d2qr0q1, d2qr0q2, d2qr0r1, d2qr0r2, d2qr0s1, d2qr0s2, d2qr0t1, d2qr0t2, d2qr0u1, d2qr0v1, d2qr0w1, d2qr0w2, d2qr0x1, d2qr0x2 |