Lineage for d2qr0o1 (2qr0 O:13-107)

  1. Root: SCOPe 2.08
  2. 3029608Class g: Small proteins [56992] (100 folds)
  3. 3033576Fold g.17: Cystine-knot cytokines [57500] (1 superfamily)
    disulfide-rich fold; common core is all-beta
  4. 3033577Superfamily g.17.1: Cystine-knot cytokines [57501] (8 families) (S)
  5. 3033578Family g.17.1.1: Platelet-derived growth factor-like [57502] (4 proteins)
  6. 3033590Protein Vascular endothelial growth factor, VEGF [57505] (3 species)
  7. 3033593Species Human (Homo sapiens) [TaxId:9606] [57506] (22 PDB entries)
    Uniprot P15692 40-133
  8. 3033638Domain d2qr0o1: 2qr0 O:13-107 [151258]
    Other proteins in same PDB: d2qr0a1, d2qr0a2, d2qr0b1, d2qr0b2, d2qr0e1, d2qr0e2, d2qr0f1, d2qr0f2, d2qr0g1, d2qr0g2, d2qr0h1, d2qr0h2, d2qr0k1, d2qr0k2, d2qr0l1, d2qr0l2, d2qr0m1, d2qr0m2, d2qr0n1, d2qr0n2, d2qr0q1, d2qr0q2, d2qr0r1, d2qr0r2, d2qr0s1, d2qr0s2, d2qr0t1, d2qr0t2, d2qr0w1, d2qr0w2, d2qr0x1, d2qr0x2
    automatically matched to d1katv_

Details for d2qr0o1

PDB Entry: 2qr0 (more details), 3.5 Å

PDB Description: structure of vegf complexed to a fab containing tyr and ser in the cdrs
PDB Compounds: (O:) Vascular Endothelial Growth Factor A

SCOPe Domain Sequences for d2qr0o1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2qr0o1 g.17.1.1 (O:13-107) Vascular endothelial growth factor, VEGF {Human (Homo sapiens) [TaxId: 9606]}
evvkfmdvyqrsychpietlvdifqeypdeieyifkpscvplmrcggccndeglecvpte
esnitmqimrikphqgqhigemsflqhnkcecrpk

SCOPe Domain Coordinates for d2qr0o1:

Click to download the PDB-style file with coordinates for d2qr0o1.
(The format of our PDB-style files is described here.)

Timeline for d2qr0o1: