SCOPe 2.08: Domain d2qr0w2: 2qr0 W:108-211

Lineage for d2qr0w2 (2qr0 W:108-211)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)

6. Protein Immunoglobulin light chain kappa constant domain, CL-kappa [88566] (4 species)

7. Species Human (Homo sapiens) [TaxId:9606] [88569] (147 PDB entries)
   including humanized antibodies (chimeric proteins with human constant domains)
   SQ NA # humanized antibody ! Uniprot P01834 # KAC_HUMAN Ig kappa chain C region ! SQ P01834 # KAC_HUMAN Ig kappa chain C region. ! SQ NA # engineered antibody

8. Domain d2qr0w2: 2qr0 W:108-211 [151271]
   Other proteins in same PDB: d2qr0a1, d2qr0b1, d2qr0b2, d2qr0c1, d2qr0d1, d2qr0e1, d2qr0f1, d2qr0f2, d2qr0g1, d2qr0h1, d2qr0h2, d2qr0i1, d2qr0j1, d2qr0k1, d2qr0l1, d2qr0l2, d2qr0m1, d2qr0n1, d2qr0n2, d2qr0o1, d2qr0p1, d2qr0q1, d2qr0r1, d2qr0r2, d2qr0s1, d2qr0t1, d2qr0t2, d2qr0u1, d2qr0v1, d2qr0w1, d2qr0x1, d2qr0x2
   automatically matched to d1g9ml2

Details for d2qr0w2

PDB Entry: 2qr0, 3.5 Å

PDB Description: structure of vegf complexed to a fab containing tyr and ser in the cdrs

PDB Compounds: (W:) Fab-Fragment Light Chain

SCOPe Domain Sequences for d2qr0w2:

Sequence; same for both SEQRES and ATOM records:

>d2qr0w2 b.1.1.2 (W:108-211) Immunoglobulin light chain kappa constant domain, CL-kappa {Human (Homo sapiens) [TaxId: 9606]}
rtvaapsvfifppsdeqlksgtasvvcllnnfypreakvqwkvdnalqsgnsqesvteqd
skdstyslsstltlskadyekhkvyacevthqglsspvtksfnr

Timeline for d2qr0w2:

• d2qr0w2 first appeared in SCOP 1.75
  
• d2qr0w2 appears in SCOPe 2.07