SCOPe 2.08: Domain d2qoxi1: 2qox I:73-141

Lineage for d2qoxi1 (2qox I:73-141)

1. Root: SCOPe 2.08

2. Class a: All alpha proteins [46456] (290 folds)

3. Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies)
   core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down

4. Superfamily a.4.7: Ribosomal protein L11, C-terminal domain [46906] (1 family)

5. Family a.4.7.1: Ribosomal protein L11, C-terminal domain [46907] (1 protein)

6. Protein Ribosomal protein L11, C-terminal domain [46908] (6 species)

7. Species Escherichia coli [TaxId:562] [158349] (29 PDB entries)
   Uniprot P0A7J7 73-141

8. Domain d2qoxi1: 2qox I:73-141 [151071]
   Other proteins in same PDB: d2qox01, d2qox11, d2qox31, d2qox41, d2qoxc1, d2qoxc2, d2qoxd1, d2qoxe1, d2qoxf1, d2qoxg1, d2qoxg2, d2qoxh1, d2qoxh2, d2qoxi2, d2qoxj1, d2qoxk1, d2qoxl1, d2qoxm1, d2qoxn1, d2qoxo1, d2qoxp1, d2qoxq1, d2qoxr1, d2qoxs1, d2qoxt1, d2qoxu1, d2qoxv1, d2qoxw1, d2qoxx1, d2qoxy1, d2qoxz1
   protein/RNA complex; complexed with mg, zn
   protein/RNA complex; complexed with mg, zn

Details for d2qoxi1

PDB Entry: 2qox, 3.93 Å

PDB Description: Crystal structure of the bacterial ribosome from Escherichia coli in complex with spectinomycin. This file contains the 50S subunit of the second 70S ribosome. The entire crystal structure contains two 70S ribosomes.

PDB Compounds: (I:) 50S ribosomal protein L11

SCOPe Domain Sequences for d2qoxi1:

Sequence; same for both SEQRES and ATOM records:

>d2qoxi1 a.4.7.1 (I:73-141) Ribosomal protein L11, C-terminal domain {Escherichia coli [TaxId: 562]}
ppaavllkkaagiksgsgkpnkdkvgkisraqlqeiaqtkaadmtgadieamtrsiegta
rsmglvved

Timeline for d2qoxi1:

• d2qoxi1 first appeared in SCOP 1.75
  
• d2qoxi1 appears in SCOPe 2.07